FCRL3/FcRH3 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-09272

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-09272-100ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

0.5 mg/ml

View all FCRL3/FcRH3 Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human FCRL3/FcRH3. Peptide sequence RGSSLSDAVHVEFSPDWLILQALHPVFEGDNVILRCQGKDNKNTHQKVYY

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for FCRL3/FcRH3 Antibody

Western Blot: FCRL3/FcRH3 Antibody [NBP3-09272]

Western Blot: FCRL3/FcRH3 Antibody [NBP3-09272]

Western Blot: FCRL3/FcRH3 Antibody [NBP3-09272] - Western blot analysis of FCRL3/FcRH3 in OVCAR-3 Whole cell lysates. Antibody dilution at 1.0ug/ml

Applications for FCRL3/FcRH3 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: FCRL3/FcRH3

The FCRL3 gene codes for a member of the immunoglobulin receptor superfamily, a Fc receptor-like protein 3 that has seven isoforms: isoform 1: 734 amino acids long, 80 kDA; isoform 2: 639 amino acids long, nearly 70 kDA; isoform 3: 740 amino acids long, 81 kDA; isoform 4: 189 amino acids long, 21 kDA; isoform 5: 199 amino acids long, 22 kDA; isoform 6: 742 amino acid long, 81 kDA; and isoform 7: 707 amino acids long, 77 kDA. This protein functions in the moderation of the immune system as it obtains immunoreceptor-tyrosine activation motifs as well as immunoreceptor-tyrosine inhibitory motifs in its cytoplasmic domain. It is known to interact with genes SYK, PTPN6, ZAP70, and PTPN11. FCRL3 is linked to multiple sclerosis, graves' disease, arthritis, lupus, rheumatoid arthritis, alopecia areata, behcet's disease, and primary biliary cirrhosis.

Long Name

Fc Receptor-like 3

Alternate Names

CD307c, FcRH3, IFGP3, IRTA3, SPAP2

Gene Symbol

FCRL3

Additional FCRL3/FcRH3 Products

Product Documents for FCRL3/FcRH3 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for FCRL3/FcRH3 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.