Skip to main content

Recombinant Human TCIRG1 GST (N-Term) Protein

Novus Biologicals, part of Bio-Techne | Catalog # H00010312-Q02

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
H00010312-Q02-10ug
H00010312-Q02-25ug

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Conjugate

Unconjugated

Applications

ELISA, Affinity Purification, Microarray, SDS-PAGE, Western Blot

Product Specifications

Description

A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 138-235 of Human TCIRG1

Source: Wheat Germ (in vitro)

Amino Acid Sequence: PQLAAAHTDGASERTPLLQAPGGPHQDLRVNFVAGAVEPHKAPALERLLWRACRGFLIASFRELEQPLEHPVTGEPATWMTFLISYWGEQIGQKIRKI

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

36.52 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human TCIRG1 GST (N-Term) Protein

SDS-PAGE: Recombinant Human TCIRG1 GST (N-Term) Protein [H00010312-Q02]

SDS-PAGE: Recombinant Human TCIRG1 GST (N-Term) Protein [H00010312-Q02]

SDS-Page: Recombinant Human TCIRG1 Protein [H00010312-Q02] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation and Storage

H00010312-Q02
Preparation Method in vitro wheat germ expression system
Formulation 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -80C. Avoid freeze-thaw cycles.

Background: TCIRG1

Through alternate splicing, this gene encodes two proteins with similarity to subunits of the vacuolar ATPase (V-ATPase) but the encoded proteins seem to have different functions. V-ATPase is a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, and receptor-mediated endocytosis. V-ATPase is comprised of a cytosolic V1 domain and a transmembrane V0 domain. Mutations in this gene are associated with infantile malignant osteopetrosis. [provided by RefSeq]

Long Name

T-cell Immune Regulator 1

Alternate Names

Atp6i, ATP6N1C, OC116, OPTB1, Stv1, TIRC7, Vph1

Gene Symbol

TCIRG1

Additional TCIRG1 Products

Product Documents for Recombinant Human TCIRG1 GST (N-Term) Protein

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Recombinant Human TCIRG1 GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...