Myosin 1A Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-85349

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-85349-0.1ml
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

0.5 mg/ml

View all Myosin 1A Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human Myosin 1A. Peptide sequence: ILEDNSFEQFVINYCNEKLQQVFIEMTLKEEQEEYKREGIPWTKVDYFDN The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for Myosin 1A Antibody

Western Blot: Myosin 1A Antibody [NBP2-85349]

Western Blot: Myosin 1A Antibody [NBP2-85349]

Western Blot: Myosin 1A Antibody [NBP2-85349] - Host: Rabbit. Target Name: MYO1A. Sample Tissue: Human THP-1 Whole Cell lysates. Antibody Dilution: 1ug/ml

Applications for Myosin 1A Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Myosin 1A

MYO1A, also known as Unconventional myosin-Ia, is a 1,043 amino acid protein that is 118 kDa, expressed by enterocytes, the epithelial cells that line the luminal surface of the small intestine, functions as actin-based molecular motor that, upon interaction with actin filaments, utilize energy from ATP hydrolysis to generate mechanical force, and potentially it is involved in directing the movement of organelles along actin filaments. Current research is being performed on this proteins involvement in deafness, autosomal dominant 48, spinal cord injury, brachial plexus injuries, sensorineural hearing loss, chronic obstructive pulmonary disease, myotonic dystrophy, pulmonary disease, t cell deficiency, and retinitis. The protein has been linked to the RhoA pathway, antioxidant action of vitamin-C, transendothelial migration of leukocytes, actin nucleation by ARP-WASP complex, epithelial adherens junctions, cellular effects of sildenafil, ILK signaling, epithelial tight junctions, RhoGDI pathway, PAK pathway, and Fc-GammaR-mediated phagocytosis in macrophages pathways where it interacts with BAZ1B, FBL, MAP3K3, SMARCA5, USP20, NEK6, PHLDA3, and over 50 other proteins.

Alternate Names

BBMI, BBM-I, Brush border myosin I, brush border myosin-I, DFNA48, MIHC, MYHL, Myosin I heavy chain, myosin IA, myosin, heavy polypeptide-like (100kD), myosin-Ia

Gene Symbol

MYO1A

Additional Myosin 1A Products

Product Documents for Myosin 1A Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Myosin 1A Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.