ELA-32 (human)

Name: ELA-32 (human)
Brand: Tocris Bioscience
SKU: 6291

Tocris Bioscience, part of Bio-Techne | Catalog # 6291

COA / SDS

Potent and high affinity apelin agonist; stimulates angiogenesis

Discontinued Product

6291 has been discontinued. View all Apelin Receptor Agonists products.

Key Product Details

Description:	Potent and high affinity apelin agonist; stimulates angiogenesis
Alternative Names:	APJ early endogenous ligand,Apela,Elabela,Toddler
Molecular Weight:	3967.8

View Full Technical Details for ELA-32 (human)

Technical Data
Citations

Biological Activity for ELA-32 (human)

ELA-32 (human) is a potent, high affinity apelin receptor agonist (IC₅₀ = 0.27 nM; K_d = 0.51 nM). Exhibits no binding GPR15 and GPR25. Activates the PI3K/AKT pathway and promotes self-renewal of hESCs via cell-cycle progression and protein translation. Also potentiates the TGFβ pathway, priming hESCs toward the endoderm lineage. Stimulates angiogenesis in HUVEC cells. Relaxes mouse aortic vessels. Functions as an anorexigenic hormone through activation of the AVP and CRH neurons in the PVN.

Negative control (Cat.No. 6292) also available.

Licensing Information

Sold under agreement from the Agency for Science, Technology and Research (A*STAR), ETPL, and affiliates including the Institute of Medical Biology.

Technical Data for ELA-32 (human)

M. Wt	3967.8
Formula	C₁₇₀H₂₈₉N₆₃O₃₉S₄
Single Letter Sequence	QRPVNLTMRRKLRKHNCLQRRCMPLHSRVPFP (Modifications: Disulfide bridge: 17-22)
Storage	Store at -20°C
CAS Number	1680205-79-1
PubChem ID	131648248
InChi Key	QSDOQAYDPQAWEK-PXWSXZDTSA-N
Smiles	[H]N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N1CCC[C@H]1C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@H]1CSSC[C@H](NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CC(C)C)NC1=O)C(=O)N[C@@H](CCSC)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C(C)C)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N1CCC[C@H]1C(O)=O

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

Tocris products are intended for laboratory research use only, unless stated otherwise.

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

Mass

Concentration

Volume

M. Wt*

g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and CoA (available online).

Dilution Calculator

Calculate the dilution required to prepare a stock solution.

Concentration 1 (C1)

Volume 1 (V1)

Concentration 2 (C2)

Volume 2 (V2)

Reconstitution Calculator

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

Volume (to add to vial)

Mass (in vial)

Desired Reconstitution Concentration

References for ELA-32 (human)

References are publications that support the biological activity of the product.

Santoso Central action of ELABELA reduces food intake and activates arginine vasopressin and corticotropin-releasing hormone neurons in the hypothalamic paraventricular nucleus. Neuroreport 2015 PMID: 26237243
Yang Elabela/Toddler Is an endogenous agonist of the apelin APJ receptor in the adult cardiovascular system, and exogenous administration of the peptide compensates for the downregulation of its expression in pulmonary arterial hypertension. Circulation 2017 PMID: 28137936
Ho ELABELA Is an Endogenous Growth Factor that Sustains hESC Self-Renewal via the PI3K/AKT Pathway. Cell Stem Cell 2015 PMID: 26387754
Chng ELABELA: a hormone essential for heart development signals via the apelin receptor. Dev.Cell 2013 PMID: 24316148
Chaves-Almagro Apelin receptors: From signaling to antidiabetic strategy. Eur.J.Pharmacol. 2015 PMID: 26007641
Wang Elabela-apelin receptor signaling pathway is functional in mammalian systems. Sci.Rep. 2015 PMID: 25639753
Deng Apela Regulates Fluid Homeostasis by Binding to the APJ Receptor to Activate G_i Signaling. J.Biol.Chem 2015 PMID: 25995451