Alpha Actinin 3 Antibody - Azide and BSA Free
Novus Biologicals, part of Bio-Techne | Catalog # NBP2-92608
Key Product Details
Species Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
Azide and BSA Free
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Product Specifications
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 580-630 of human ACTN3 (NP_001095.2). GAIMGIQGEIQKICQTYGLRPCSTNPYITLSPQDINTKWDMVRKLVPSCDQ
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
103 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Scientific Data Images for Alpha Actinin 3 Antibody - Azide and BSA Free
![Western Blot: Alpha Actinin 3 AntibodyAzide and BSA Free [NBP2-92608]](https://resources.bio-techne.com/images/products/Alpha-Actinin-3-Antibody-Western-Blot-NBP2-92608-img0002.jpg "Western Blot: Alpha Actinin 3 AntibodyAzide and BSA Free [NBP2-92608]")
Western Blot: Alpha Actinin 3 AntibodyAzide and BSA Free [NBP2-92608]
Western Blot: Alpha Actinin 3 Antibody [NBP2-92608] - Analysis of extracts of various cell lines, using Alpha Actinin 3 at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 10s.![Immunohistochemistry-Paraffin: Alpha Actinin 3 Antibody - Azide and BSA Free [NBP2-92608]](https://resources.bio-techne.com/images/products/Alpha-Actinin-3-Antibody-Immunohistochemistry-Paraffin-NBP2-92608-img0004.jpg "Immunohistochemistry-Paraffin: Alpha Actinin 3 Antibody - Azide and BSA Free [NBP2-92608]")
Immunohistochemistry-Paraffin: Alpha Actinin 3 Antibody - Azide and BSA Free [NBP2-92608]
Immunohistochemistry-Paraffin: Alpha Actinin 3 Antibody [NBP2-92608] - Immunohistochemistry of paraffin-embedded rat skeletal muscle using Alpha Actinin 3 Rabbit pAb (NBP2-92608) at dilution of 1:500 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.![Immunohistochemistry-Paraffin: Alpha Actinin 3 Antibody - Azide and BSA Free [NBP2-92608]](https://resources.bio-techne.com/images/products/Alpha-Actinin-3-Antibody-Immunohistochemistry-Paraffin-NBP2-92608-img0003.jpg "Immunohistochemistry-Paraffin: Alpha Actinin 3 Antibody - Azide and BSA Free [NBP2-92608]")
Immunohistochemistry-Paraffin: Alpha Actinin 3 Antibody - Azide and BSA Free [NBP2-92608]
Immunohistochemistry-Paraffin: Alpha Actinin 3 Antibody [NBP2-92608] - Immunohistochemistry of paraffin-embedded mouse skeletal muscle using Alpha Actinin 3 Rabbit pAb (NBP2-92608) at dilution of 1:500 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.Applications for Alpha Actinin 3 Antibody - Azide and BSA Free
Application
Recommended Usage
Immunohistochemistry
1:100 - 1:500
Western Blot
1:500 - 1:2000
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS with 50% glycerol, pH7.3.
Format
Azide and BSA Free
Preservative
0.01% Thimerosal
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: Alpha Actinin 3
Alternate Names
actinin, alpha 3, alpha-actinin skeletal muscle, Alpha-actinin skeletal muscle isoform 3, alpha-actinin-3, F-actin cross-linking protein, MGC117002, MGC117005
Gene Symbol
ACTN3
Additional Alpha Actinin 3 Products
Product Documents for Alpha Actinin 3 Antibody - Azide and BSA Free
Product Specific Notices for Alpha Actinin 3 Antibody - Azide and BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Loading...
Loading...
Loading...
Loading...
⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov