GABA-A R rho 2 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-80061

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-80061
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

0.5 mg/ml

View all GABA-A R rho 2 Antibodies »

Product Specifications

Immunogen

Synthetic peptide directed towards the middle region of human GABRR2 (NP_002034). Peptide sequence SNKSMTFDGRLVKKIWVPDVFFVHSKRSFTHDTTTDNIMLRVFPDGHVLY. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

54 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for GABA-A R rho 2 Antibody

Western Blot: GABA-A R rho 2 Antibody [NBP1-80061]

Western Blot: GABA-A R rho 2 Antibody [NBP1-80061]

Western Blot: GABA-A R rho 2 Antibody [NBP1-80061] - Sample Type: Human Fetal Brain Antibody Dilution: 1.0 ug/ml
Immunohistochemistry: GABA-A R rho 2 Antibody [NBP1-80061]

Immunohistochemistry: GABA-A R rho 2 Antibody [NBP1-80061]

Immunohistochemistry: GABA-A R rho 2 Antibody [NBP1-80061] - Formalin Fixed Paraffin Embedded Tissue: Human Adult heart Observed Staining: Membrane(tight junctions - intercalated disks) Primary Antibody Concentration: 1:600 Secondary Antibody: Donkey anti-Rabbit-Cy2/3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec Protocol located in Reviews and Data.
Western Blot: GABA-A R rho 2 Antibody [NBP1-80061]

Western Blot: GABA-A R rho 2 Antibody [NBP1-80061]

Western Blot: GABA-A R rho 2 Antibody [NBP1-80061] - Hela cell lysate, concentration 0.2-1 ug/ml.
View 3 more images

Applications for GABA-A R rho 2 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: GABA-A R rho 2

GABA is the major inhibitory neurotransmitter in the mammalian brain where it acts at GABA receptors, which are ligand-gated chloride channels. The protein encoded by this gene is a member of the rho subunit family and is a component of the GABA receptor complex. (provided by RefSeq)

Long Name

gamma-Aminobutyric Acid Type A Receptor, rho 2 Polypeptide

Alternate Names

GABA-C R rho 2, GABAAR rho 2, GABAARr2, GABRR2

Entrez Gene IDs

2570 (Human)

Gene Symbol

GABRR2

UniProt

P28476

Additional GABA-A R rho 2 Products

Product Documents for GABA-A R rho 2 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for GABA-A R rho 2 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.