GNGT1 Antibody - Azide and BSA Free

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-04725

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-04725-20ul
NBP3-04725-100ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Mouse, Rat

Applications

Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

View all GNGT1 Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-45 of human GNGT1 (NP_068774.1). MPVINIEDLTEKDKLKMEVDQLKKEVTLERMLVSKCCEEVRDYVE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

8 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for GNGT1 Antibody - Azide and BSA Free

Western Blot: GNGT1 AntibodyAzide and BSA Free [NBP3-04725]

Western Blot: GNGT1 AntibodyAzide and BSA Free [NBP3-04725]

Western Blot: GNGT1 Antibody [NBP3-04725] - Analysis of extracts of various cell lines, using GNGT1 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit
Immunohistochemistry: GNGT1 Antibody - Azide and BSA Free [NBP3-04725]

Immunohistochemistry: GNGT1 Antibody - Azide and BSA Free [NBP3-04725]

Immunohistochemistry: GNGT1 Antibody [NBP3-04725] - Analysis of mouse eye using GNGT1 antibody at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunohistochemistry: GNGT1 Antibody - Azide and BSA Free [NBP3-04725]

Immunohistochemistry: GNGT1 Antibody - Azide and BSA Free [NBP3-04725]

Immunohistochemistry: GNGT1 Antibody [NBP3-04725] - Analysis of rat eye using GNGT1 antibody at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Applications for GNGT1 Antibody - Azide and BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:100

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS with 50% glycerol, pH7.3.

Format

Azide and BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: GNGT1

GNGT1, also known as Guanine nucleotide-binding protein G(T) subunit gamma-T1, is a 74 amino acid that is 8 kDa, composed of 3 units, alpha, beta and gamma; found in the cell membrane; linked to 7-TM receptors; modulates or transduces in various transmembrane signaling systems; and its beta and gamma chains are requisite for the GTPase activity, for substitution of GDP by GTP, and for G protein-effector interaction. Studies on this protein has shown a relationship with fructose-1,6-bisphosphatase deficiency, retinitis pigmentosa, retinitis, and hypoxia. The GNGT1 protein has also shown an interaction with approx. 300 proteins including GNB1, GNB3, IKBKG, GNAS, and PLEKHB1 in several pathways including chemotaxis CXCR4 signaling pathway, translation regulation by Alpha-1 adrenergic receptors, development activation of ERK by Alpha-1 adrenergic receptors, cytoskeleton remodeling Role of PKA in cytoskeleton reorganization, development A1 receptor signaling, GPCR downstream signaling, transmission across chemical synapses, signaling by GPCR, G protein gated potassium channels, and neuronal system pathway.

Alternate Names

GNG1, guanine nucleotide binding protein (G protein), gamma transducing activitypolypeptide 1, guanine nucleotide-binding protein G(T) subunit gamma-T1, Transducin gamma chain

Gene Symbol

GNGT1

Additional GNGT1 Products

Product Documents for GNGT1 Antibody - Azide and BSA Free

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for GNGT1 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.