MED15 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-37851

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-37851
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

0.5 mg/ml

View all MED15 Antibodies »

Product Summary for MED15 Antibody

Immunogen

The immunogen for Anti-MED15 antibody is: synthetic peptide directed towards the C-terminal region of Human MED15.. Peptide sequence: TPQSMPPPPQPSPQPGQPSSQPNSNVSSGPAPSPSSFLPSPSPQPSQSPV The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

86 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for MED15 Antibody

Western Blot: MED15 Antibody [NBP2-37851]

Western Blot: MED15 Antibody [NBP2-37851]

Western Blot: MED15 Antibody [NBP2-37851] - Host: Rabbit. Target Name: MED15. Sample Type: Fetal Liver lysates. Antibody Dilution: 1.0ug/ml
Western Blot: MED15 Antibody [NBP2-37851]

Western Blot: MED15 Antibody [NBP2-37851]

Western Blot: MED15 Antibody [NBP2-37851] - Fetal Liver lysates, Antibody Dilution: 1.0 ug/ml.
Western Blot: MED15 Antibody [NBP2-37851]

Western Blot: MED15 Antibody [NBP2-37851]

Western Blot: MED15 Antibody [NBP2-37851] - Host: Rabbit. Target Name: MED15. Sample Tissue: Human ACHN Whole Cell. Antibody Dilution: 1ug/ml

Applications for MED15 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MED15

MED15 is encoded by this gene is a subunit of the multiprotein complexes PC2 and ARC/DRIP and may function as a transcriptional coactivator in RNA polymerase II transcription. This gene contains stretches of trinucleotide repeats and is located in the chromosome 22 region which is deleted in DiGeorge syndrome. Two transcript variants encoding different isoforms have been found for this gene.

Alternate Names

ARC105Arc105, CAG7A, CTG repeat protein 7a, CTG7A, FLJ42282, FLJ42935, mediator complex subunit 15PC2 glutamine/Q-rich-associated protein, mediator of RNA polymerase II transcription subunit 15, PC2 (positive cofactor 2, multiprotein complex) glutamine/Q-rich-associatedprotein, PC2-glutamine-rich-associated protein, PCQAPDKFZp686A2214, Positive cofactor 2 glutamine/Q-rich-associated protein, positive cofactor 2, glutamine/Q-rich-associated protein, TIG1DKFZp762B1216, TIG-1TPA-inducible gene 1 protein, TNRC7, TPA inducible gene-1, TPA inducible protein, trinucleotide repeat containing 7,105-kD, Trinucleotide repeat-containing gene 7 protein

Gene Symbol

MED15

UniProt

Q96RN5 (Human)

Additional MED15 Products

Product Documents for MED15 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for MED15 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.