RGS19 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-88150

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-88150
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

0.5 mg/ml

View all RGS19 Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human RGS19. Peptide sequence: HDTASPAAPSRNPCCLCWCCCCSCSWNQERRRAWQASRESKLQPLPSCEV The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for RGS19 Antibody

Western Blot: RGS19 Antibody [NBP2-88150]

Western Blot: RGS19 Antibody [NBP2-88150]

Western Blot: RGS19 Antibody [NBP2-88150] - WB Suggested Anti-RGS19 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:1562500. Positive Control: Human brain

Applications for RGS19 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RGS19

G proteins mediate a number of cellular processes. The protein encoded by this gene belongs to the RGS (regulators of G-protein signaling) family and specifically interacts with G protein, GAI3. This protein is a guanosine triphosphatase-activating protein that functions to down-regulate Galpha i/Galpha q-linked signaling. Alternatively spliced transcript variants encoding the same protein isoform have been found for this gene.; FUNCTION: Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits thereby driving them into their inactive GDP-bound form. Binds to G-alpha subfamily 1 members, with the order G(i)a3 > G(i)a1 > G(o)a >> G(z)a/G(i)a2. Activity on G(z)-alpha is inhibited by phosphorylation and palmitoylation of the G-protein. SUBCELLULAR LOCATION: Membrane; Lipid-anchor. TISSUE SPECIFICITY: Highest expression in lung. Placenta, liver and heart also express high levels of GAIP.

Alternate Names

G alpha interacting protein, GAIPG protein signalling regulator 19, G-alpha-interacting protein, GNAI3IP, guanine nucleotide binding protein alpha inhibiting activity polypeptide 3interacting protein, regulator of G-protein signaling 19, regulator of G-protein signalling 19, RGSGAIP

Gene Symbol

RGS19

Additional RGS19 Products

Product Documents for RGS19 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for RGS19 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.