Skip to main content

CDC26 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-91771PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP1-91771PEP

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CDC26.

Source: E. coli

Amino Acid Sequence: MLRRKPTRLELKLDDIEEFENIRKDLETRKKQKEDVEVVGGSDGEGAIGLSSDPKSREQMINDRIGYKPQPKPNNRSSQFGSL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-91771.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP1-91771PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: CDC26

The protein encoded by the CDC26 gene is highly similar to Saccharomyces cerevisiae Cdc26, a component of cell cycleanaphase-promoting complex (APC). APC is composed of a group of highly conserved proteins and functions as a cellcycle-regulated ubiquitin-protein ligase. APC thus is responsible for the cell cycle regulated proteolysis of variousproteins. (provided by RefSeq)

Alternate Names

ANAPC12chromosome 9 open reading frame 17, Anaphase-promoting complex subunit 12, anaphase-promoting complex subunit CDC26, APC12anaphase promoting complex subunit 12, C9orf17, CDC26 subunit of anaphase promoting complex, cell division cycle 26, cell division cycle 26 homolog (S. cerevisiae), Cell division cycle protein 26 homolog

Gene Symbol

CDC26

Additional CDC26 Products

Product Documents for CDC26 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for CDC26 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...