Recombinant Human CHRNB3 GST (N-Term) Protein

Name: Recombinant Human CHRNB3 GST (N-Term) Protein
Brand: Novus Biologicals
SKU: H00001142-P01

Novus Biologicals, part of Bio-Techne | Catalog # H00001142-P01

Submit a review

Product Datasheet / COA / SDS

Discontinued Product

H00001142-P01 has been discontinued. View all Nicotinic Acetylcholine R beta 3/CHRNB3 products.

Product Specifications
Scientific Data
Preparation & Storage
Background
Product Documents
Specific Notices

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Conjugate

Unconjugated

Applications

ELISA, Affinity Purification, Microarray, SDS-PAGE, Western Blot

View all Nicotinic Acetylcholine R beta 3/CHRNB3 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-458 of Human CHRNB3

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MLPDFMLVLIVLGIPSSATTGFNSIAENEDALLRHLFQGYQKWVRPVLHSNDTIKVYFGLKISQLVDVDEKNQLMTTNVWLKQEWTDHKLRWNPDDYGGIHSIKVPSESLWLPDIVLFENADGRFEGSLMTKVIVKSNGTVVWTPPASYKSSCTMDVTFFPFDRQNCSMKFGSWTYDGTMVDLILINENVDRKDFFDNGEWEILNAKGMKGNRRDGVYSYPFITYSFVLRRLPLFYTLFLIIPCLGLSFLTVLVFYLPSDEGEKLSLSTSVLVSLTVFLLVIEEIIPSSSKVIPLIGEYLLFIMIFVTLSIIVTVFVINVHHRSSSTYHPMAPWVKRLFLQKLPKLLCMKDHVDRYSSPEKEESQPVVKGKVLEKKKQKQLSDGEKVLVAFLEKAADSIRYISRHVKKEHFISQVVQDWKFVAQVLDRIFLWLFLIVSVTGSVLIFTPALKMWLHSYH

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

79.1 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human CHRNB3 GST (N-Term) Protein

SDS-PAGE: Recombinant Human CHRNB3 GST (N-Term) Protein [H00001142-P01]

SDS-Page: Recombinant Human CHRNB3 Protein [H00001142-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation and Storage

H00001142-P01

Preparation Method	in vitro wheat germ expression system
Formulation	50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative	No Preservative
Concentration	Please see the vial label for concentration. If unlisted please contact technical services.
Shipping	The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage	Store at -80C. Avoid freeze-thaw cycles.

Background: Nicotinic Acetylcholine R beta 3/CHRNB3

CHRNB3 is associated with subjective responses to tobacco. Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator). Observational study and genome-wide association study of gene-disease association. (HuGE Navigator). Observational study of gene-disease association. (HuGE Navigator). absence of differences in the pharmacological profile of nicotinic receptor alpha3beta4 argues against role for incorporated beta3 subunit in formation of agonist binding sites while changes in channel kinetics suggest important effect on receptor gating

Long Name

Nicotinic Acetylcholine Receptor beta 3

Alternate Names

CHRNB3, NAChRB3

Gene Symbol

CHRNB3

Additional Nicotinic Acetylcholine R beta 3/CHRNB3 Products

Product Documents for Recombinant Human CHRNB3 GST (N-Term) Protein

Product Datasheets

Download Product Datasheets

COA

SDS

Download SDS

Product Specific Notices for Recombinant Human CHRNB3 GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Citations
Reviews