ERK5/BMK1 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-58369PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-58369PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Conjugate

Unconjugated

Applications

Antibody Competition

View all ERK5/BMK1 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ERK5/BMK1.

Source: E. coli

Amino Acid Sequence: DDEPDCAPPFDFAFDREALTRERIKEAIVAEIEDFHARREGIRQQIRFQPSLQPVASEPGCPDVEMPSPWAPSGDCAMESPPPA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58369.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-58369PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: ERK5/BMK1

The extracellular signal-regulated kinase 5 (ERK5), also known as MAPK7 or big mitogen-activated protein kinase 1 (BMK1), is a member of the MAP kinase subfamily (1). ERK5 differs considerably from other MAPKs; it contains an unusually long carboxyl-terminal tail which might contribute to the regulation of its activity and/or localization. In response to extracellular signals, ERK5 translocates to the nucleus, where it regulates gene expression by phosphorylating, and activating different transcription factors (2). ERK5 also differs from other MAPKs in possessing a potent transcriptional activation domain which mediates protein-protein interactions with the myocyte enhancer factor 2 (MEF2) transcription factors (3). ERK5 is specifically activated by MAPK kinase 5 (MAP2K5/MEK5) and plays an important role in mammary epithelial proliferation, endothelial cell survival and normal embryonic development (4-5).

Long Name

Extracellular Signal-regulated Kinase 5

Alternate Names

BMK1, MAPK7

Gene Symbol

MAPK7

Additional ERK5/BMK1 Products

Product Documents for ERK5/BMK1 Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for ERK5/BMK1 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.