Follistatin-like 4/FSTL4 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-91913PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-91913PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

View all Follistatin-like 4/FSTL4 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human FSTL4.

Source: E. coli

Amino Acid Sequence: WMDPGTSRGPDVGVGESQAEEPRSFEVTRREGLSSHNELLASCGKKFCSRGSRCVLSRKTGEPECQCLEACRPSYVPVCGS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-91913.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP1-91913PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: Follistatin-like 4/FSTL4

FSTL4 (Follistatin-like protein 4; also FSL4, SPIG1 and D/Bsp120I-1) is a likely secreted, 90 kDa (predicted) member of the follistatin gene family of TGF-beta superfamily inhibitors. It is widely expressed, being found in neurons (retinal ganglion and cerebellar Purkinje cells), cardiac muscle cells, smooth muscle cells and intestinal epithelium. Mature mouse FSTL4 is 819 amino acids (aa) in length (aa 23-841). It contains one kazal-like domain (aa 80-134), an EF-hand motif (aa 173-208), and two Ig-like domains (aa 250-336 and 340-425). There are two potential splice forms, one that shows an alternative start site at Met315, and a second that possesses a His residue substitution for aa 518-841. Full-length mature mouse FSTL4 shares 95% and 84% aa identity with rat and human FSTL4, respectively.

Alternate Names

Follistatin like 4, FSL4, FSTL4

Gene Symbol

FSTL4

Additional Follistatin-like 4/FSTL4 Products

Product Documents for Follistatin-like 4/FSTL4 Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Follistatin-like 4/FSTL4 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.