Recombinant Human GIYD2 GST (N-Term) Protein

Name: Recombinant Human GIYD2 GST (N-Term) Protein
Brand: Novus Biologicals
SKU: H00079008-P01

Novus Biologicals, part of Bio-Techne | Catalog # H00079008-P01

Submit a review

Product Datasheet / COA / SDS

Discontinued Product

H00079008-P01 has been discontinued. View all GIYD2 products.

Product Specifications
Scientific Data
Preparation & Storage
Background
Product Documents
Specific Notices

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Conjugate

Unconjugated

Applications

ELISA, Affinity Purification, Microarray, Western Blot

View all GIYD2 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-275 of Human GIYD2

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MGPAGVAARPGRFFGVYLLYCLNPRYRGRVYVGFTVNTARRVQQHNGGRKKGGAWRTSGRGPWEMVLVVHGFPSSVAALRFEWAWQHPHASRRLAHVGPRLRGETAFAFHLRVLAHMLRAPPWARLPLTLRWVRPDLRQDLCLPPPPHVPLAFGPPPPQAPAPRRRAGPFDDAEPEPDQGDPGACCSLCAQTIQDEEGPLCCPHPGCLLRAHVICLAEEFLQEEPGQLLPLEGQCPCCEKSLLWGDLIWLCQMDTEKEVEDSELEEAHWTDLLET

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

57.2 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human GIYD2 GST (N-Term) Protein

12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation and Storage

H00079008-P01

Preparation Method	in vitro wheat germ expression system
Formulation	50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative	No Preservative
Concentration	Please see the vial label for concentration. If unlisted please contact technical services.
Shipping	The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage	Store at -80C. Avoid freeze-thaw cycles.

Background: GIYD2

A segmental duplication of the p arm of chromosome 16 created two identical copies of the GIY-YIG domain containing gene, this record represents the more telomeric copy. Exons of this gene overlap with exons of the phenol-preferring sulfotransferase (SULT1A4) gene. Two transcript variants that encode different protein isoforms have been identified through sequence analysis. [provided by RefSeq]

Alternate Names

EC 3.6.1.-, FLJ23439, GIYD1, GIYD2, GIY-YIG domain containing 2, GIY-YIG domain-containing protein 1, MGC2532, MGC5178, SLX1, SLX1 structure-specific endonuclease subunit homolog B (S. cerevisiae), SLX1A, structure-specific endonuclease subunit SLX1

Gene Symbol

SLX1B

Additional GIYD2 Products

Product Documents for Recombinant Human GIYD2 GST (N-Term) Protein

Product Datasheets

Download Product Datasheets

COA

SDS

Download SDS

Product Specific Notices for Recombinant Human GIYD2 GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Citations
Reviews