Recombinant Human GnRHR Protein

Novus Biologicals, part of Bio-Techne | Catalog # H00002798-G01-10ug

Novus Biologicals, part of Bio-Techne
Discontinued Product
H00002798-G01-10ug has been discontinued. View all GnRHR products.

Key Product Details

Source

Wheat germ

Conjugate

Unconjugated

Applications

Affinity Purification

View all GnRHR Proteins and Enzymes »

Product Specifications

Description

An un-tagged recombinant protein corresponding GNRHR (ADR83139.1)

Source: Wheat Germ (in vitro) with proprietary liposome technology

Amino Acid Sequence: MANSASPEQNQNHCSAINNSIPLMQGNLPTLTLSGKIRVTVTFFLFLLSATFNASFLLKLQKWTQKKEKGKKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYLKLFSMYAPAFMMVVISLDRSLAITRPLALKSNSKVGQSMVGLAWILSSVFAGPQLYIFRMIHLADSSGQTKVFSQCVTHCSFSQWWHQAFYNFFTFSCLFIIPLFIMLICNAKIIFTLTRVLHQDPHELQLNQSKNNIPRARLKTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEMLNRLSDPVNHFFFLFAFLNPCFDPLIYGYFSL

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

36.1 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Formulation, Preparation and Storage

H00002798-G01-10ug
Preparation Method in vitro wheat germ expression system with proprietary liposome technology
Formulation 25 mM Tris-HCl pH8.0 in 2% glycerol.
Preservative Glycerol
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -80C. Avoid freeze-thaw cycles.

Background: GnRHR

GnRHR encodes the receptor for type 1 gonadotropin-releasing hormone. This receptor is a member of the seven-transmembrane, G-protein coupled receptor (GPCR) family. It is expressed on the surface of pituitary gonadotrope cells as well as lymphocytes, breast, ovary, and prostate. Following binding of gonadotropin-releasing hormone, the receptor associates with G-proteins that activate a phosphatidylinositol-calcium second messenger system. Activation of the receptor ultimately causes the release of gonadotropic luteinizing hormone (LH) and follicle stimulating hormone (FSH). Defects in this gene are a cause of hypogonadotropic hypogonadism (HH). Alternative splicing results in multiple transcript variants encoding different isoforms. More than 18 transcription initiation sites in the 5' region and multiple polyA signals in the 3' region have been identified for this gene.

Long Name

Gonadotropin-releasing Hormone Receptor

Alternate Names

GNRHR1, GRHR, HH7, LHRHR, LRHR, Luliberin

Gene Symbol

GNRHR

OMIM

138850 (Human)

Additional GnRHR Products

Product Documents for Recombinant Human GnRHR Protein

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Recombinant Human GnRHR Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.