Recombinant Human mGluR1 GST (N-Term) Protein

Name: Recombinant Human mGluR1 GST (N-Term) Protein
Brand: Novus Biologicals
SKU: H00002911-Q01

Novus Biologicals, part of Bio-Techne | Catalog # H00002911-Q01

Submit a review

Product Datasheet / COA / SDS

Discontinued Product

H00002911-Q01 has been discontinued. View all mGluR1 products.

Product Specifications
Scientific Data
Preparation & Storage
Background
Product Documents
Specific Notices

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Conjugate

Unconjugated

Applications

ELISA, Affinity Purification, Microarray, Western Blot

View all mGluR1 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 387-486 of Human mGluR1

Source: Wheat Germ (in vitro)

Amino Acid Sequence: NPNFKRICTGNESLEENYVQDSKMGFVINAIYAMAHGLQNMHHALCPGHVGLCDAMKPIDGSKLLDFLIKSSFIGVSGEEVWFDEKGDAPGRYDIMNLQY

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human mGluR1 GST (N-Term) Protein

Recombinant Human mGluR1 Protein [H00002911-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation and Storage

H00002911-Q01

Preparation Method	in vitro wheat germ expression system
Formulation	50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative	No Preservative
Concentration	Please see the vial label for concentration. If unlisted please contact technical services.
Shipping	The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage	Store at -80C. Avoid freeze-thaw cycles.

Background: mGluR1

The Metabotropic Glutamate Receptor mGluR1 binds L-glutamate, the major excitatory neurotransmitter in the central nervous system, which activates both ionotropic and metabotropic glutamate receptors. Glutamatergic neurotransmission is involved in most aspects of normal brain function and can be perturbed in many neuropathologic conditions. mGluR1 and mGluR5 are group I receptors that have been shown to activate phospholipase C. Alternative splice variants of the mGluR1 gene have been described, but their full-length nature has not been determined. Inflammation results in the activation of mGluR1 and mGluR5 in dorsal horn neurons of the spinal cord, leading to extracellular signal-regulated kinase (ERK) activation, which is required for nociceptive plasticity and enhanced pain. mGluR1 has been reported in various regions of the brain and spinal cord. ESTs have been isolated from brain and eye libraries. Caution: GLUR1 refers to Ionotropic Glutamate Receptor 1, not to Metabotropic Glutamate Receptor 1 (mGLUR1).

Long Name

Metabotropic Glutamate Receptor 1

Alternate Names

GPRC1A, GRM1

Gene Symbol

GRM1

Additional mGluR1 Products

Product Documents for Recombinant Human mGluR1 GST (N-Term) Protein

Product Datasheets

Download Product Datasheets

COA

SDS

Download SDS

Product Specific Notices for Recombinant Human mGluR1 GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Citations
Reviews