Recombinant Human MyD88 GST (N-Term) Protein

Name: Recombinant Human MyD88 GST (N-Term) Protein
Brand: Novus Biologicals
SKU: H00004615-P01

Novus Biologicals, part of Bio-Techne | Catalog # H00004615-P01

Submit a review

Citations (1)

Product Datasheet / COA / SDS

Discontinued Product

H00004615-P01 has been discontinued. View all MyD88 products.

Product Specifications
Scientific Data
Preparation & Storage
Background
Product Documents
Specific Notices

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Conjugate

Unconjugated

Applications

ELISA, Affinity Purification, Immunoprecipitation, Microarray, Western Blot

View all MyD88 Proteins and Enzymes »

Product Specifications

Description

Recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-296 of Human MYD88

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MAAGGPGAGSAAPVSSTSSLPLAALNMRVRRRLSLFLNVRTQVAADWTALAEEMDFEYLEIRQLETQADPTGRLLDAWQGRPGASVGRLLELLTKLGRDDVLLELGPSIEEDCQKYILKQQQEEAEKPLQVAAVDSSVPRTAELAGITTLDDPLGHMPERFDAFICYCPSDIQFVQEMIRQLEQTNYRLKLCVSDRDVLPGTCVWSIASELIEKRCRRMVVVVSDDYLQSKECDFQTKFALSLSPGAHQKRLIPIKYKAMKKEFPSILRSITVCDYTNPCTKSWFWTRLAKALSLP

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

58.3 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Application Notes

Use in immunprecipitation reported in scientific literature (PMID 25808990)

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human MyD88 GST (N-Term) Protein

SDS-PAGE: Recombinant Human MyD88 GST (N-Term) Protein [H00004615-P01]

SDS-Page: Recombinant Human MyD88 Protein [H00004615-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue

Formulation, Preparation and Storage

H00004615-P01

Preparation Method	in vitro wheat germ expression system
Formulation	50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative	No Preservative
Concentration	Please see the vial label for concentration. If unlisted please contact technical services.
Shipping	The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage	Store at -80C. Avoid freeze-thaw cycles.

Background: MyD88

Myeloid differentiation Marker 88 (MyD88) is a universal adaptor molecule for the Toll/IL1R and is involved in the inflammatory response induced by IL1, IL18 and LPS. MyD88 associates with and recruits IRAK to IL1 receptor complex in response to IL1. This pathway further leads to activation of NFkB. Targeted disruption of the MyD88 gene results in lose of cellular responses to IL1 and IL18, and MyD88 deficient mice lack responses to bacterial product LPS that employs Toll like receptors 2 and 4 as the signaling receptors.

Long Name

Myeloid Differentiation Primary Response Gene 88

Alternate Names

MYD88D, myeloid differentiation primary response gene (88), myeloid differentiation primary response protein MyD88

Gene Symbol

MYD88

Additional MyD88 Products

Product Documents for Recombinant Human MyD88 GST (N-Term) Protein

Product Datasheets

Download Product Datasheets

COA

SDS

Download SDS

Product Specific Notices for Recombinant Human MyD88 GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Citations
Reviews