Recombinant Human ORF1 FL49 GST (N-Term) Protein
Novus Biologicals, part of Bio-Techne | Catalog # H00084418-P02

Discontinued Product
H00084418-P02 has been discontinued.
View all ORF1 FL49 products.
Key Product Details
Source
Wheat germ
Tag
GST (N-Term)
Conjugate
Unconjugated
Applications
ELISA, Affinity Purification, Microarray, Western Blot
Product Specifications
Description
Recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-97 of Human1-FL49
Source: Wheat Germ (in vitro)
Amino Acid Sequence: MNQENPPPYPGPGPTAPYPPYPPQPMGPGPMGGPYPPPQGYPYQGYPQYGWQGGPQEPPKTTVYVVEDQRRDELGPSTCLTACWTALCCSCLWDMLT
Purity
>80% by SDS-PAGE and Coomassie blue staining
Predicted Molecular Mass
37 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Activity
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Protein / Peptide Type
Recombinant Protein
Scientific Data Images for Recombinant Human ORF1 FL49 GST (N-Term) Protein
12.5% SDS-PAGE Stained with Coomassie Blue.
Formulation, Preparation and Storage
H00084418-P02
Preparation Method | in vitro wheat germ expression system |
Formulation | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
Preservative | No Preservative |
Concentration | Please see the vial label for concentration. If unlisted please contact technical services. |
Shipping | The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below. |
Stability & Storage | Store at -80C. Avoid freeze-thaw cycles. |
Background: ORF1 FL49
Alternate Names
chromosome 5 open reading frame 32, hypothetical protein LOC84418, ORF1-FL49, putative nuclear protein ORF1-FL49
Gene Symbol
CYSTM1
Additional ORF1 FL49 Products
Product Documents for Recombinant Human ORF1 FL49 GST (N-Term) Protein
Product Specific Notices for Recombinant Human ORF1 FL49 GST (N-Term) Protein
This product is produced by and distributed for Abnova, a company based in Taiwan.
This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.
Loading...
Loading...
Loading...
Loading...