PSP94/MSMB Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-33610PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-33610PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

View all PSP94/MSMB Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MSMB.

Source: E. coli

Amino Acid Sequence: LKGNKHPINSEWQTDNCETCTCYETEISCCTLVSTPVGYDKDNCQRIFKKEDCKYIVVEKKDPK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-33610.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-33610PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: PSP94/MSMB

PSP94 (prostate secretory protein of 94 amino acids; also named beta-MSP) is a secreted, non-glycosylated member of the beta-microseminoprotein family. The 94 amino acid (aa) mature PSP94 contains no classic motifs or domains, but does have ten Cys that are conserved across species. It is expressed in mucoid secretions, but its function is unknown. PSP94 is abundant in prostatic fluid, which is the exclusive source in rodents. Gastric and respiratory secretory epithelia are also significant sources in humans. Human PSP94 circulates bound to a 71 kDa PSP binding protein, possibly disulfide-linked. The seminal fluid protein CRISP-3 can also bind PSP94. PSP94 has been proposed as an alternative to PSA as a serum marker for prostate cancer. When total (bound plus free) PSP94 is considered, its secretion is found to be down-regulated in cancer cells, creating below normal circulating levels. Its size is predicted at 11 kDa, but may appear to be 16 kDa due to anomalous migration. A 61 aa variant, formed by C-terminal proteolysis, is increased in prostate secretions from patients with benign prostatic hyperplasia. A prostate-specific alternate splice form shows a substitution of 41 aa for the C-terminal 78 aa. Mature human PSP94 shares 53%, 46%, 43%, and 42% aa identity with porcine, rat, mouse, and chicken PSP94, respectively. Most of the ten primate sequences available show less than 80% aa identity. PSP94 has been proposed as a species barrier protein due to its low evolutionary conservation and abundance in seminal fluid.

Long Name

Prostate Secretory Protein of 94 Amino Acids/Microseminoprotein, beta

Alternate Names

IGBF, MSMB, MSPB, PIP, PN44, PRPS, PSP57

Gene Symbol

MSMB

Additional PSP94/MSMB Products

Product Documents for PSP94/MSMB Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for PSP94/MSMB Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.