RIZ1 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-89644PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-89644PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

View all RIZ1 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PRDM2.

Source: E. coli

Amino Acid Sequence: PPPFQYHHRNPMGIGVTATNFTTHNIPQTFTTAIRCTKCGKGVDNMPELHKHILACASASDKKRYTPKKNPVPLKQTVQPKNGVVVLDNSGKNAFRRMGQPKRLNFSVELSKMSSNKLKLNALKKKNQLVQKAI

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89644.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP1-89644PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: RIZ1

RIZ1 (Retinoblastoma proteininteracting zinc finger), also known as PRDM2, is a nuclear protein containing 8 zinc finger motifs. RIZ1 contains a PR domain that may function as protein binding interface in the regulation of chromatin-mediated gene expression. RIZ 1 acts as a tumor suppressor, and RIZ 1 inactivation is common in many types of human cancers, including neuroendocrine, breast, liver, colon, skin, and lymphoid tumors. Similarly, RIZ1 over-expression in breast cancer cells caused cell cycle arrest in G2-M and apoptosis. RIZ1 is highly expressed in human retinoblastoma cells and at low levels in all other human cell lines.

Alternate Names

EC 2.1.1.43, GATA-3 binding protein G3B, GATA-3-binding protein G3B, KMT8PR domain-containing protein 2, Lysine N-methyltransferase 8, MTB-ZFHUMHOXY1, PR domain containing 2, with ZNF domain, PR domain zinc finger protein 2, retinoblastoma protein-binding zinc finger protein, Retinoblastoma protein-interacting zinc finger protein, RIZ1, RIZ2, RIZMTE-binding protein, Zinc finger protein RIZ, zinc-finger DNA-binding protein

Gene Symbol

PRDM2

Additional RIZ1 Products

Product Documents for RIZ1 Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for RIZ1 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.