Recombinant Human SLC35A1 GST (N-Term) Protein

Name: Recombinant Human SLC35A1 GST (N-Term) Protein
Brand: Novus Biologicals
SKU: H00010559-P01

Novus Biologicals, part of Bio-Techne | Catalog # H00010559-P01

Submit a review

Product Datasheet / COA / SDS

Discontinued Product

H00010559-P01 has been discontinued. View all SLC35A1 products.

Product Specifications
Scientific Data
Preparation & Storage
Background
Product Documents
Specific Notices

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Conjugate

Unconjugated

Applications

ELISA, Affinity Purification, Microarray, Western Blot

View all SLC35A1 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-337 of Human SLC35A1

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MAAPRDNVTLLFKLYCLAVMTLMAAVYTIALRYTRTSDKELYFSTTAVCITEVIKLLLSVGILAKETGSLGRFKASLRENVLGSPKELLKLSVPSLVYAVQNNMAFLALSNLDAAVYQVTYQLKIPCTALCTVLMLNRTLSKLQWVSVFMLCAGVTLVQWKPAQATKVVVEQNPLLGFGAIAIAVLCSGFAGVYFEKVLKSSDTSLWVRNIQMYLSGIIVTLAGVYLSDGAEIKEKGFFYGYTYYVWFVIFLASVGGLYTSVVVKYTDNIMKGFSAAAAIVLSTIASVMLFGLQITLTFALGTLLVCVSIYLYGLPRQDTTSIQQGETASKERVIGV

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

63.2 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human SLC35A1 GST (N-Term) Protein

12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation and Storage

H00010559-P01

Preparation Method	in vitro wheat germ expression system
Formulation	50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative	No Preservative
Concentration	Please see the vial label for concentration. If unlisted please contact technical services.
Shipping	The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage	Store at -80C. Avoid freeze-thaw cycles.

Background: SLC35A1

The SLC35A1 gene encodes a CMP-sialic acid transporter located within the membrane of the Golgi apparatus. The transporter moves nucleotide sugars across the membrane for use in glycosylation reactions that take place within the Golgi department (Eckhardt et al., 1996 [PubMed 8755516]). For background information on the SLC35 family of nucleotide-sugar transporters, see SLC35A3 (MIM 605632).[supplied by OMIM]

Alternate Names

CDG2F, CMP-SA-Tr, CMP-sialic acid transporter, CMP-Sia-Tr, CMPST, CST, FLJ76955, hCST, mutated CMP-sialic acid transporter A1, solute carrier family 35 (CMP-sialic acid transporter), member 1, solute carrier family 35 (CMP-sialic acid transporter), member A1, solute carrier family 35 (UDP-galactose transporter), member 1, Solute carrier family 35 member A1

Gene Symbol

SLC35A1

Additional SLC35A1 Products

Product Documents for Recombinant Human SLC35A1 GST (N-Term) Protein

Product Datasheets

Download Product Datasheets

COA

SDS

Download SDS

Product Specific Notices for Recombinant Human SLC35A1 GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Citations
Reviews