Recombinant Human Speedy/Ringo GST (N-Term) Protein

Name: Recombinant Human Speedy/Ringo GST (N-Term) Protein
Brand: Novus Biologicals
SKU: H00245711-P01

Novus Biologicals, part of Bio-Techne | Catalog # H00245711-P01

Submit a review

Citations (1)

Product Datasheet / COA / SDS

Discontinued Product

H00245711-P01 has been discontinued. View all Speedy/Ringo products.

Product Specifications
Scientific Data
Preparation & Storage
Background
Product Documents
Specific Notices

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Conjugate

Unconjugated

Applications

ELISA, Affinity Purification, Microarray, Western Blot

View all Speedy/Ringo Proteins and Enzymes »

Product Specifications

Description

A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-313 of Human SPDYA

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MRHNQMCCETPPTVTVYVKSGSNRSHQPKKPITLKRPICKDNWQAFEKNTHNNNKSKRPKGPCLVIQRQDMTAFFKLFDDDLIQDFLWMDCCCKIADKYLLAMTFVYFKRAKFTISEHTRINFFIALYLANTVEEDEEETKYEIFPWALGKNWRKLFPNFLKLRDQLWDRIDYRAIVSRRCCEEVMAIAPTHYIWQRERSVHHSGAVRNYNRDEVQLPRGPSATPVDCSLCGKKRRYVRLGLSSSSSLSSHTAGVTEKHSQDSYNSLSMDIIGDPSQAYTGSEVVNDHQSNKGKKTNFLKKDKSMEWFTGSEE

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

62.9 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human Speedy/Ringo GST (N-Term) Protein

12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation and Storage

H00245711-P01

Preparation Method	in vitro wheat germ expression system
Formulation	50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative	No Preservative
Concentration	Please see the vial label for concentration. If unlisted please contact technical services.
Shipping	The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage	Store at -80C. Avoid freeze-thaw cycles.

Background: Speedy/Ringo

Speedy/Ringo (Spy1 or SPDYA) regulates the G1/S phase transition of the cell cycle by binding and activating CDC2, CDK2 and CDKN1B/KIP1. It mediates cell survival during the DNA damage process through activation of CDK2. Tight regulation of Speedy is important for the somatic cell cycle. Speedy overexpression has been linked to hepatocellular cancer.

Alternate Names

hSpy/Ringo A, MGC110856, Rapid inducer of G2/M progression in oocytes A, RINGO A, RINGO3, SPDY1, speedy homolog 1 (Drosophila), speedy homolog A (Xenopus laevis), speedy protein A, speedy-1, Spy1, SPY1MGC57218

Gene Symbol

SPDYA

Additional Speedy/Ringo Products

Product Documents for Recombinant Human Speedy/Ringo GST (N-Term) Protein

Product Datasheets

Download Product Datasheets

COA

SDS

Download SDS

Product Specific Notices for Recombinant Human Speedy/Ringo GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Citations
Reviews