Skip to main content

STK35 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-30644PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-30644PEP

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human STK35.

Source: E. coli

Amino Acid Sequence: TSLKRRHQNVVQFEECVLQRNGLAQRMSHGNKSSQLYLRLVET

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-30644.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-30644PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: STK35

STK35 associates with the PDZ-LIM protein CLP36 through the LIM domain and undergoes autophosphorylation in vitro. STK35 localizes predominantly to the nucleus; however, cotransfection of STK35 with CLP36 demonstrated redistribution of STK35 to the cytoplasm and into actin stress fibers, where it colocalizes with CLP36. The presence of STK35 disrupted the periodic staining pattern of CLP36 in these fibers. It is suggested that CLP36 specifically targets STK35 to actin stress fibers and that STK35 may represent a regulator of the actomyosin cytoskeleton in nonmuscle cells.

Alternate Names

bA550O8.2, CLIK-1, CLIK1Serine/threonine-protein kinase 35 L1, CLP-36 interacting kinase, CLP-36-interacting kinase 1, EC 2.7.11, EC 2.7.11.1, PDIK1, PDLIM1-interacting kinase 1, serine threonine kinase 35 long form, serine/threonine kinase 35, serine/threonine-protein kinase 35, STK35L1

Gene Symbol

STK35

Additional STK35 Products

Product Documents for STK35 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for STK35 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...