Amyloid β-Peptide (1-40) (human)

Name: Amyloid β-Peptide (1-40) (human)
Brand: Tocris Bioscience
SKU: 1191

Tocris Bioscience, part of Bio-Techne | Catalog # 1191

Citations (8)

COA / SDS

Amyloid β-protein fragment

Key Product Details

Description:	Amyloid β-protein fragment
Purity:	≥95% (HPLC)
Molecular Weight:	4329.86

View Full Technical Details for Amyloid β-Peptide (1-40) (human)

Technical Data
Citations

Biological Activity for Amyloid β-Peptide (1-40) (human)

Amyloid β-Peptide (1-40) (human) is a peptide found in plaques in the brains of patients with Alzheimer's disease. Shown to have both neurotrophic and neurotoxic effects.

Technical Data for Amyloid β-Peptide (1-40) (human)

M. Wt	4329.86
Formula	C₁₉₄H₂₉₅N₅₃O₅₈S
Single Letter Sequence	DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Storage	Store at -20°C
Purity	≥95% (HPLC)
CAS Number	131438-79-4
PubChem ID	16135555
InChi Key	FEWOUVRMGWFWIH-ILZZQXMPSA-N
Smiles	[H]N[C@@H](CC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](C(C)C)C(=O)NCC(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N[C@@H](C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)CC)C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](C(C)C)C(=O)NCC(=O)NCC(=O)N[C@@H](C(C)C)C(=O)N[C@@H](C(C)C)C(O)=O

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

Tocris products are intended for laboratory research use only, unless stated otherwise.

Solubility for Amyloid β-Peptide (1-40) (human)

Solubility

Soluble to 1mg/ml in water

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

Mass

Concentration

Volume

M. Wt*

g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and CoA (available online).

Dilution Calculator

Calculate the dilution required to prepare a stock solution.

Concentration 1 (C1)

Volume 1 (V1)

Concentration 2 (C2)

Volume 2 (V2)

Reconstitution Calculator

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

Volume (to add to vial)

Mass (in vial)

Desired Reconstitution Concentration

References for Amyloid β-Peptide (1-40) (human)

References are publications that support the biological activity of the product.

Yankner Neurotrophic and neurotoxic effects of amyloid β protein: reversal by tachykinin neuropeptides. Science 1990 PMID: 2218531
Kowalska and Badellino β-Amyloid protein induces platelet aggregation and supports platelet adhesion. Biochem.Biophys.Res.Commun. 1994 PMID: 7811271
Miguel-Hidalgo and Cacabelos Beta-amyloid(1-40)-induced neurodegeneration in the rat hippocampal neurons of the CA1 subfield. Acta Neuropathol. 1998 PMID: 9600591
Cleary Beta-amyloid(1-40) effects on behavior and memory. Brain Res. 1995 PMID: 7552329