Calcitonin (salmon)

Name: Calcitonin (salmon)
Brand: Tocris Bioscience
SKU: 1159

Tocris Bioscience, part of Bio-Techne | Catalog # 1159

COA / SDS

Affects bone formation and resorption

Key Product Details

Description:	Affects bone formation and resorption
Purity:	≥95% (HPLC)
Molecular Weight:	3431.9

View Full Technical Details for Calcitonin (salmon)

Technical Data
Citations

Biological Activity for Calcitonin (salmon)

Stimulates bone formation by osteoblasts and inhibits bone resorption.

Technical Data for Calcitonin (salmon)

M. Wt	3431.9
Formula	C₁₄₅H₂₄₀N₄₄O₄₈S₂
Single Letter Sequence	CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP (Modifications: Disulfide bridge: 1-7, Pro-32 = C-terminal amide)
Storage	Store at -20°C
Purity	≥95% (HPLC)
CAS Number	47931-85-1
PubChem ID	16133812
InChi Key	BBBFJLBPOGFECG-VJVYQDLKSA-N
Smiles	[H]N[C@H]1CSSC[C@H](NC(=O)[C@@H](NC(=O)[C@H](CO)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CO)NC1=O)[C@@H](C)O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)NCC(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H]([C@@H](C)O)C(=O)N1CCC[C@H]1C(N)=O

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

Tocris products are intended for laboratory research use only, unless stated otherwise.

Solubility for Calcitonin (salmon)

Solubility

Soluble to 1mg/ml in water

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

Mass

Concentration

Volume

M. Wt*

g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and CoA (available online).

Dilution Calculator

Calculate the dilution required to prepare a stock solution.

Concentration 1 (C1)

Volume 1 (V1)

Concentration 2 (C2)

Volume 2 (V2)

Reconstitution Calculator

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

Volume (to add to vial)

Mass (in vial)

Desired Reconstitution Concentration

References for Calcitonin (salmon)

References are publications that support the biological activity of the product.

van Rossum Neuroanatomical localization, pharmacological characterization and functions of CGRP, related peptides and their receptors. Neurosci.Biobehav.Rev. 1997 PMID: 9353797
Poyner Pharmacology of receptors for calcitonin gene-related peptide and amylin. TiPS 1995 PMID: 8578616