CRF (human, rat)

Name: CRF (human, rat)
Brand: Tocris Bioscience
SKU: 1151

Tocris Bioscience, part of Bio-Techne | Catalog # 1151

Citations (17)

COA / SDS

Stimulates ACTH release

Key Product Details

Description:	Stimulates ACTH release
Alternative Names:	Corticotropin-Releasing Factor (human,rat)
Purity:	≥95% (HPLC)
Molecular Weight:	4758

View Full Technical Details for CRF (human, rat)

Technical Data
Citations

Biological Activity for CRF (human, rat)

CRF (human, rat) is a endogenous peptide agonist for the CRF receptor (K_i values are 11, 44 and 38 nM for hCRF₁, rCRF_2a and mCRF_2b respectively). Stimulates the synthesis and release of ACTH from the anterior pituitary.

Licensing Information

Sold with the permission of the SALK Institute

Technical Data for CRF (human, rat)

M. Wt	4758
Formula	C₂₀₈H₃₄₄N₆₀O₆₃S₂
Single Letter Sequence	SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII (Modifications: Ile-41 = C-terminal amide)
Storage	Store at -20°C
Purity	≥95% (HPLC)
CAS Number	86784-80-7
PubChem ID	16132357
InChi Key	VXFVFWFSJFSXHN-FAUHKOHMSA-N
Smiles	[H]N[C@@H](CO)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N1CCC[C@H]1C(=O)N1CCC[C@H]1C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)CC)C(N)=O

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

Tocris products are intended for laboratory research use only, unless stated otherwise.

Solubility for CRF (human, rat)

Solubility

Soluble to 1.1mg/ml in water

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

Mass

Concentration

Volume

M. Wt*

g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and CoA (available online).

Dilution Calculator

Calculate the dilution required to prepare a stock solution.

Concentration 1 (C1)

Volume 1 (V1)

Concentration 2 (C2)

Volume 2 (V2)

Reconstitution Calculator

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

Volume (to add to vial)

Mass (in vial)

Desired Reconstitution Concentration

References for CRF (human, rat)

References are publications that support the biological activity of the product.

Vale Characterization of a 41-residue ovine hypothalamic peptide that stimulates secretion of cortico. and β-endorphin. Science 1981 PMID: 6267699
Perrin Comparison of an agonist, urocortin, and an antagonist, astressin, as radioligands for characterization of corticotropin-releasing factor receptors. J.Pharmacol.Exp.Ther. 1999 PMID: 9918582
Tache Inhibition of gastric acid secretion in rats by intracerebral injection of corticotropin-releasing factor. Science 1983 PMID: 6415815
Souza Corticotropin-releasing factor receptors in rat forebrain: autoradiographic identification. Science 1984 PMID: 6328656
Rivier Mediation by cortico. releasing factor (CRF) of adenohypophysial hormone secretion. Annu.Rev.Physiol. 1986 PMID: 2871808
Perrin and Vale Corticotropin releasing factor receptors and their ligand family. Ann.N.Y.Acad.Sci. 1999 PMID: 10816663