Echistatin, α1 isoform

Name: Echistatin, α1 isoform
Brand: Tocris Bioscience
SKU: 3202

Tocris Bioscience, part of Bio-Techne | Catalog # 3202

Citations (1)

COA / SDS

αVβ3 and glycoprotein IIb/IIIa (integrin αIIbβ3) inhibitor

Key Product Details

Description:	α_Vβ₃ and glycoprotein IIb/IIIa (integrin α_IIbβ₃) inhibitor
Purity:	≥95% (HPLC)
Molecular Weight:	5417.1

View Full Technical Details for Echistatin, α1 isoform

Technical Data
Citations

Biological Activity for Echistatin, α1 isoform

Echistatin, α1 isoform is a potent irreversible α_Vβ₃ integrin antagonist (K_i = 0.27 nM). Disrupts attachment of osteoclasts to bone and inhibits bone reabsorption (IC₅₀ = 0.1 nM). Prevents ADP-induced platelet aggregation via inhibition of glycoprotein IIb/IIIa (GpIIb/IIIa, α_IIbβ₃) receptors (IC₅₀ = 30 nM) in vitro.

Technical Data for Echistatin, α1 isoform

M. Wt	5417.1
Formula	C₂₁₇H₃₄₁N₇₁O₇₄S₉
Single Letter Sequence	ECESGPCCRNCKFLKEGTICKRARGDDMDDYCNGKTCDCPRNPHKGPAT (Modifications: Disulfide bridges: 2-11, 7-32, 8-37, 20-39)
Storage	Store at -20°C
Purity	≥95% (HPLC)
CAS Number	154303-05-6
PubChem ID	90488810
InChi Key	KZMZKUVIDVBQGX-UHFFFAOYSA-N
Smiles	[H]N[C@@H](CCC(O)=O)C(=O)N[C@H]1CSSC[C@@H]2NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@@H]3CSSC[C@@H]4NC(=O)[C@@H](NC(=O)[C@H](CCCCN)NC(=O)CNC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CSSC[C@H](NC(=O)[C@@H]5CCCN5C(=O)CNC(=O)[C@H](CO)NC(=O)[C@H](CCC(O)=O)NC1=O)C(=O)N3)NC(=O)[C@H](CC1=CC=C(O)C=C1)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCSC)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(O)=O)NC(=O)CNC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](C)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CSSC[C@H](NC(=O)[C@H](CC(O)=O)NC4=O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(N)=O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N1CCC[C@H]1C(=O)N[C@@H](C)C(=O)N[C@@H]([C@@H](C)O)C(O)=O)NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC1=CC=CC=C1)NC(=O)[C@H](CCCCN)NC2=O)[C@@H](C)O)[C@@H](C)CC)[C@@H](C)O

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

Tocris products are intended for laboratory research use only, unless stated otherwise.

Solubility for Echistatin, α1 isoform

Solubility

Soluble to 1mg/ml in water

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

Mass

Concentration

Volume

M. Wt*

g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and CoA (available online).

Dilution Calculator

Calculate the dilution required to prepare a stock solution.

Concentration 1 (C1)

Volume 1 (V1)

Concentration 2 (C2)

Volume 2 (V2)

Reconstitution Calculator

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

Volume (to add to vial)

Mass (in vial)

Desired Reconstitution Concentration

References for Echistatin, α1 isoform

References are publications that support the biological activity of the product.

Sato Echistatin is a potent inhibitor of bone resorption in culture. J.Cell.Biol. 1990 PMID: 2211834
Kumar Biochemical characteriation of the binding of echistatin to integrin α_Vβ₃ receptor. J.Pharmacol.Exp.Ther. 1997 PMID: 9353406
Musial Inhibition of platelet adhesion to surfaces of extracorporeal circuits by disintegrins RGD-containing peptides from viper venoms. Circulation 1990 PMID: 2364514