Exendin-3 (9-39) amide

Name: Exendin-3 (9-39) amide
Brand: Tocris Bioscience
SKU: 2081

Tocris Bioscience, part of Bio-Techne | Catalog # 2081

Citations (58)

COA / SDS

Potent GLP-1 receptor antagonist

Key Product Details

Description:	Potent GLP-1 receptor antagonist
Purity:	≥95% (HPLC)
Molecular Weight:	3369.79

View Full Technical Details for Exendin-3 (9-39) amide

Technical Data
Citations

Biological Activity for Exendin-3 (9-39) amide

Exendin-3 (9-39) amide is a potent and selective GLP-1 receptor antagonist (K_d = 1.7 nM at cloned human GLP-1 receptors). Inhibits cAMP production and insulin release induced by GLP-1 (7-36), exendin-3 (IC₅₀ = 20 nM) and exendin-4. Blocks the inhibitory effect of GLP-1 on food intake in rats.

Technical Data for Exendin-3 (9-39) amide

M. Wt	3369.79
Formula	C₁₄₉H₂₃₄N₄₀O₄₇S
Single Letter Sequence	DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS (Modifications: Ser-31 = C-terminal amide)
Storage	Store at -20°C
Purity	≥95% (HPLC)
CAS Number	133514-43-9
PubChem ID	16198321
InChi Key	WSEVKKHALHSUMB-MVNVRWBSSA-N
Smiles	[H]N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC1=CNC2=C1C=CC=C2)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(=O)NCC(=O)NCC(=O)N1CCC[C@H]1C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H](C)C(=O)N1CCC[C@H]1C(=O)N1CCC[C@H]1C(=O)N1CCC[C@H]1C(=O)N[C@@H](CO)C(N)=O

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

Tocris products are intended for laboratory research use only, unless stated otherwise.

Solubility for Exendin-3 (9-39) amide

Solubility

Soluble to 1mg/ml in water

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

Mass

Concentration

Volume

M. Wt*

g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and CoA (available online).

Dilution Calculator

Calculate the dilution required to prepare a stock solution.

Concentration 1 (C1)

Volume 1 (V1)

Concentration 2 (C2)

Volume 2 (V2)

Reconstitution Calculator

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

Volume (to add to vial)

Mass (in vial)

Desired Reconstitution Concentration

References for Exendin-3 (9-39) amide

References are publications that support the biological activity of the product.

Turton A role for glucagon-like peptide-1 in the central regulation of feeding. Nature 1996 PMID: 8538742
Goke Exendin-4 is a high potency agonist and truncated exendin-(9-39)-amide an antagonist at the glucagon-like peptide 1-(7-36)-amide receptor of Ins-Secr.g β-cells. J.Biol.Chem. 1993 PMID: 8396143
Thorens Cloning and functional expression of the human islet GLP-1 receptor. Demonstration that exendin-4 is an agonist and exendin-(9-39) an antagonist of the receptor. Diabetes 1993 PMID: 8405712
Raufman Exendin-3, a novel peptide from the Heloderma horridum venom, interacts with vasoactive intestinal peptide receptors and a newly described receptor on dispersed acini from guinea pig pancreas. J.Biol.Chem. 1991 PMID: 1704369