Exendin-4

Name: Exendin-4
Brand: Tocris Bioscience
SKU: 1933

Tocris Bioscience, part of Bio-Techne | Catalog # 1933

Citations (74)

COA / SDS

Potent GLP-1 receptor agonist

Key Product Details

Description:	Potent GLP-1 receptor agonist
Alternative Names:	Exenatide,AC 2993
Purity:	≥95% (HPLC)
Molecular Weight:	4186.61

View Full Technical Details for Exendin-4

Technical Data
Citations

Biological Activity for Exendin-4

Exendin-4 is a high affinity glucagon-like peptide 1 (GLP-1) receptor agonist (K_d = 136 pM); originally isolated from Heloderma suspectum venom. Exendin-4 potently induces cAMP formation without stimulating amylase release in pancreatic acini. Potentiates glucose-induced insulin secretion in isolated rat islets. Exendin-4 protects against glutamate-induced neurotoxicity, and in a mouse model of metabolic imblance it reduces neuroinflammation and enhances long-term-potentiation.

Technical Data for Exendin-4

M. Wt	4186.61
Formula	C₁₈₄H₂₈₂N₅₀O₆₀S
Single Letter Sequence	HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS (Modifications: Ser-39 = C-terminal amide)
Storage	Store at -20°C
Purity	≥95% (HPLC)
CAS Number	141758-74-9
PubChem ID	16157882
InChi Key	HTQBXNHDCUEHJF-XWLPCZSASA-N
Smiles	[H]N[C@@H](CC1=CNC=N1)C(=O)NCC(=O)N[C@@H](CCC(O)=O)C(=O)NCC(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC1=CNC2=C1C=CC=C2)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(=O)NCC(=O)NCC(=O)N1CCC[C@H]1C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H](C)C(=O)N1CCC[C@H]1C(=O)N1CCC[C@H]1C(=O)N1CCC[C@H]1C(=O)N[C@@H](CO)C(N)=O

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

Tocris products are intended for laboratory research use only, unless stated otherwise.

Solubility for Exendin-4

Solubility

Soluble to 1mg/ml in water

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

Mass

Concentration

Volume

M. Wt*

g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and CoA (available online).

Dilution Calculator

Calculate the dilution required to prepare a stock solution.

Concentration 1 (C1)

Volume 1 (V1)

Concentration 2 (C2)

Volume 2 (V2)

Reconstitution Calculator

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

Volume (to add to vial)

Mass (in vial)

Desired Reconstitution Concentration

References for Exendin-4

References are publications that support the biological activity of the product.

Wang Exendin-4 improves long-term potentiation and neuronal dendritic growth in vivo and in vitro obesity condition. Sci.Rep. 2021 PMID: 33859286
Perry Protection and reversal of excitotoxic neuronal damage by glucagon-like peptide-1 and exendin-4. J.Pharmacol.Exp.Ther. 2002 PMID: 12183643
Goke Exendin-4 is a high potency agonist and truncated exendin-(9-39)-amide an antagonist at the glucagon-like peptide 1-(7-36)-amide receptor of Ins-Secr.g β-cells. J.Biol.Chem. 1993 PMID: 8396143
Thorens Cloning and functional expression of the human islet GLP-1 receptor. Demonstration that exendin-4 is an agonist and exendin-(9-39) an antagonist of the receptor. Diabetes 1993 PMID: 8405712
Eng Isolation and characterization of exendin-4, an exendin-3 analogue, from Heloderma suspectum venom. J.Biol.Chem. 1992 PMID: 1313797