GLP-2 (3-33)

Name: GLP-2 (3-33)
Brand: Tocris Bioscience
SKU: 7725

Tocris Bioscience, part of Bio-Techne | Catalog # 7725

COA / SDS

Peptide antagonist of glucagon-like peptide-2 (GLP-2) receptor

Key Product Details

Description:	Peptide antagonist of glucagon-like peptide-2 (GLP-2) receptor
Purity:	≥95% (HPLC)
Molecular Weight:	3557.93

View Full Technical Details for GLP-2 (3-33)

Technical Data
Citations

Biological Activity for GLP-2 (3-33)

GLP-2(3-33) is a peptide antagonist of glucagon-like peptide-2 (GLP-2) receptor. In cells, GLP-2(3-33) is generated by cleaving off the two N-terminal amino acids of GLP-2 with dipeptidylpeptidase IV (DPPIV). In high-fat diet (HFD) fed mice, GLP-2(3-33) treatment results in increased dyslipidemia and hepatic lipid accumulation. Chronic treatment of GLP-2(3-33) in HFD fed mice can cause hyperglycemia, glucose intolerance, high plasma insulin level after glucose load, increased pancreas weight and β-cell expansion.

Technical Data for GLP-2 (3-33)

M. Wt	3557.93
Formula	C₁₅₆H₂₄₂N₄₀O₅₃S
Single Letter Sequence	DGSFSDEMNTILDNLAARDFINWLIQTKITD
Storage	Store at -20°C
Purity	≥95% (HPLC)
CAS Number	275801-62-2
PubChem ID	71455345
InChi Key	MYKFSDGCGNRIEA-KXTJMAPWSA-N
Smiles	O=C(NCC(N[C@@H](CO)C(N[C@@H](CC1=CC=CC=C1)C(N[C@@H](CO)C(N[C@@H](CC(O)=O)C(N[C@@H](CCC(O)=O)C(N[C@@H](CCSC)C(N[C@@H](CC(N)=O)C(N[C@@H]([C@H](O)C)C(N[C@@H]([C@@H](C)CC)C(N[C@@H](CC(C)C)C(N[C@@H](CC(O)=O)C(N[C@@H](CC(N)=O)C(N[C@@H](CC(C)C)C(N[C@@H](C)C(N[C@@H](C)C(N[C@@H](CCCNC(N)=N)C(N[C@@H](CC(O)=O)C(N[C@@H](CC2=CC=CC=C2)C(N[C@@H]([C@@H](C)CC)C(N[C@@H](CC(N)=O)C(N[C@@H](CC3=CNC4=CC=CC=C34)C(N[C@@H](CC(C)C)C(N[C@@H]([C@@H](C)CC)C(N[C@@H](CCC(N)=O)C(N[C@@H]([C@H](O)C)C(N[C@@H](CCCCN)C(N[C@@H]([C@@H](C)CC)C(N[C@@H]([C@H](O)C)C(N[C@@H](CC(O)=O)C(O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)[C@H](CC(O)=O)N

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

Tocris products are intended for laboratory research use only, unless stated otherwise.

Solubility for GLP-2 (3-33)

Solubility

Soluble to 2mg/ml in 0.01M PBS

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

Mass

Concentration

Volume

M. Wt*

g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and CoA (available online).

Dilution Calculator

Calculate the dilution required to prepare a stock solution.

Concentration 1 (C1)

Volume 1 (V1)

Concentration 2 (C2)

Volume 2 (V2)

Reconstitution Calculator

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

Volume (to add to vial)

Mass (in vial)

Desired Reconstitution Concentration

References for GLP-2 (3-33)

References are publications that support the biological activity of the product.

Baldassano Influence of endogenous glucagon-like peptide-2 on lipid disorders in mice fed a high-fat diet. Endocr.Res. 2016 PMID: 26906293
Baldassano GLP-2 involvement as a beneficial factor in the glucose homeostasis in mice fed a high fat diet. J.Cell Physiol. 2015 PMID: 25967277