Insulin (human) recombinant, expressed in yeast

Name: Insulin (human) recombinant, expressed in yeast
Brand: Tocris Bioscience
SKU: 3435

Tocris Bioscience, part of Bio-Techne | Catalog # 3435

Citations (6)

COA / SDS

Endogenous peptide agonist

Key Product Details

Description:	Endogenous peptide agonist
Molecular Weight:	5807.57

View Full Technical Details for Insulin (human) recombinant, expressed in yeast

Technical Data
Citations

Biological Activity

Insulin (human, recombinant, expressed in yeast) is an endogenous insulin receptor agonist (K_i = 4.85 nM). Decreases plasma glucose levels, proteolysis, lipolysis and gluconeogenesis and increases glycogen and fatty acid synthesis in vivo.

Technical Data

M. Wt	5807.57
Formula	C₂₅₇H₃₈₃N₆₅O₇₇S₆
Single Letter Sequence	GIVEQCCTSICSLYQLENYCN FVNQHLCGSHLVEALYLVCGERGFFYTPKT* (Modifications: Disulfide bridges: 6-11, 7-7, 20-19)
Storage	Store at -20°C
CAS Number	11061-68-0
PubChem ID	44379551
InChi Key	YZSPVSFRBZGLIZ-QIJQHHJSSA-N
Smiles	[H]NCC(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@H]1CSSC[C@@H]2NC(=O)[C@@H](NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CSSC[C@H](NC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC3=CC=C(O)C=C3)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](C)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC3=CNC=N3)NC(=O)[C@H](CO)NC(=O)CNC(=O)[C@H](CSSC[C@H](NC(=O)[C@H](CC3=CC=C(O)C=C3)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CC3=CC=C(O)C=C3)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CO)NC2=O)C(=O)N[C@@H](CC(N)=O)C(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC2=CNC=N2)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CC(N)=O)NC(=O)[C@@H](NC(=O)[C@@H](N[H])CC2=CC=CC=C2)C(C)C)C(C)C)C(C)C)C(=O)NCC(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)NCC(=O)N[C@@H](CC2=CC=CC=C2)C(=O)N[C@@H](CC2=CC=CC=C2)C(=O)N[C@@H](CC2=CC=C(O)C=C2)C(=O)N[C@@H]([C@@H](C)O)C(=O)N2CCC[C@H]2C(=O)N[C@@H](CCCCN)C(=O)N[C@@H]([C@@H](C)O)C(O)=O)NC1=O)[C@@H](C)O)[C@@H](C)CC

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

Tocris products are intended for laboratory research use only, unless stated otherwise.

Solubility

Soluble to 10mg/ml in aq. HCl (pH 2.0 - 2.5)

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

Mass

Concentration

Volume

M. Wt*

g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and CoA (available online).

Dilution Calculator

Calculate the dilution required to prepare a stock solution.

Concentration 1 (C1)

Volume 1 (V1)

Concentration 2 (C2)

Volume 2 (V2)

Reconstitution Calculator

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

Volume (to add to vial)

Mass (in vial)

Desired Reconstitution Concentration

References

References are publications that support the biological activity of the product.

Ou The binding characteristics of Ins-MTX to Ins receptor. Hua.Xi.Yi.Ke.Da.Xue.Xue.Bao. 2001 PMID: 12528542
Leney and Tavare The molecular basis of Ins-stimulated glucose uptake: signalling, trafficking and potential drug targets. J.Endocrinol. 2009 PMID: 19389739
Torlinska Age dependent changes of Ins receptors in rat tissues. J.Physiol.Pharmacol. 2000 PMID: 11220495