Klotho-derived peptide 1

Name: Klotho-derived peptide 1
Brand: Tocris Bioscience
SKU: 7830

Tocris Bioscience, part of Bio-Techne | Catalog # 7830

COA / SDS

TGF-β receptor 2 (TβR2) binding peptide; disrupts the TGF-β/TβR2 interaction

Key Product Details

Description:	TGF-β receptor 2 (TβR2) binding peptide; disrupts the TGF-β/TβR2 interaction
Purity:	≥95% (HPLC)
Molecular Weight:	3228.48

View Full Technical Details for Klotho-derived peptide 1

Technical Data
Citations

Biological Activity for Klotho-derived peptide 1

Klotho-derived peptide 1 (KP1) is a peptide that binds to TGF-β receptor 2 (TβR2) (K_d = 1.4 μM). It inhibits TGF-β signaling by blocking TGF-β/TβR2 interaction. In mouse models of renal fibrosis, intravenous injection of KP1 results in its specific accumulation in the injured kidneys. It suppresses TGF-β signaling, repressing fibroblast activation and ameliorates kidney fibrosis in vivo.

Technical Data for Klotho-derived peptide 1

M. Wt	3228.48
Formula	C₁₄₉H₂₀₃N₃₉O₄₃
Single Letter Sequence	FQGTFPDGFLWAVGSAAYQTEGGWQQHGKG
Storage	Store at -20°C
Purity	≥95% (HPLC)
InChi Key	UYTUWBDQBGRXJP-SOZMHADISA-N
Smiles	O=C(N[C@@H](CCC(N)=O)C(NCC(N[C@@H]([C@H](O)C)C(N[C@@H](CC1=CC=CC=C1)C(N2[C@@H](CCC2)C(N[C@@H](CC(O)=O)C(NCC(N[C@@H](CC3=CC=CC=C3)C(N[C@@H](CC(C)C)C(N[C@@H](CC4=CNC5=CC=CC=C45)C(N[C@@H](C)C(N[C@@H](C(C)C)C(NCC(N[C@@H](CO)C(N[C@@H](C)C(N[C@@H](C)C(N[C@@H](CC6=CC=C(C=C6)O)C(N[C@@H](CCC(N)=O)C(N[C@@H]([C@H](O)C)C(N[C@@H](CCC(O)=O)C(NCC(NCC(N[C@@H](CC7=CNC8=CC=CC=C78)C(N[C@@H](CCC(N)=O)C(N[C@@H](CCC(N)=O)C(N[C@@H](CC9=CNC=N9)C(NCC(N[C@@H](CCCCN)C(NCC(O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)[C@H](CC%10=CC=CC=C%10)N

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

Tocris products are intended for laboratory research use only, unless stated otherwise.

Solubility for Klotho-derived peptide 1

Solubility

Soluble to 1mg/ml in water

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

Mass

Concentration

Volume

M. Wt*

g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and CoA (available online).

Dilution Calculator

Calculate the dilution required to prepare a stock solution.

Concentration 1 (C1)

Volume 1 (V1)

Concentration 2 (C2)

Volume 2 (V2)

Reconstitution Calculator

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

Volume (to add to vial)

Mass (in vial)

Desired Reconstitution Concentration

References for Klotho-derived peptide 1

References are publications that support the biological activity of the product.

Yuan A Klotho-derived peptide protects against kidney fibrosis by targeting TGF-β signaling. Nat.Commun. 2022 PMID: 35064106