LL 37

Name: LL 37
Brand: Tocris Bioscience
SKU: 5213

Tocris Bioscience, part of Bio-Techne | Catalog # 5213

Citations (15)

COA / SDS

Antimicrobial peptide derivative of human cathelicidin

Key Product Details

Description:	Antimicrobial peptide derivative of human cathelicidin
Purity:	≥95% (HPLC)
Molecular Weight:	4493.32

View Full Technical Details for LL 37

Technical Data
Citations

Biological Activity for LL 37

LL 37 is an antimicrobial peptide derivative of human cathelicidin. Induces FPRL1-mediated chemotaxis of human neutrophils, monocytes and T cells in vitro. Promotes wound healing following skin-targeted electroporation of a plasmid encoding hCAP-18/LL-37 in mice. LL 37 reduces SARS-CoV-2 infection by blocking the receptor binding domain of the S1 spike protein (K_d = 11.2 nM) and by binding to ACE2 (K_d = 25.5.nM). LL 37 inhibits SARS-CoV-2 pseudovirion infection (IC₅₀ = 4.74 μg/mL) in vitro and in vivo. Also triggers apoptosis in colon cancer cells. Cell permeable.

Technical Data for LL 37

M. Wt	4493.32
Formula	C₂₀₅H₃₄0N₆₀O₅₃
Single Letter Sequence	[LL-37, 37 aa]
Storage	Store at -20°C
Purity	≥95% (HPLC)
CAS Number	154947-66-7
PubChem ID	16198951
InChi Key	POIUWJQBRNEFGX-XAMSXPGMSA-N
Smiles	[H]N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H]([C@@H](C)CC)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CO)C(O)=O

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

Tocris products are intended for laboratory research use only, unless stated otherwise.

Solubility for LL 37

Solubility

Soluble to 1mg/ml in water

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

Mass

Concentration

Volume

M. Wt*

g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and CoA (available online).

Dilution Calculator

Calculate the dilution required to prepare a stock solution.

Concentration 1 (C1)

Volume 1 (V1)

Concentration 2 (C2)

Volume 2 (V2)

Reconstitution Calculator

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

Volume (to add to vial)

Mass (in vial)

Desired Reconstitution Concentration

References for LL 37

References are publications that support the biological activity of the product.

Wang Human cathelicidin inhibits SARS-CoV-2 infection: killing two birds with one stone. ACS Infect.Dis. 2021 PMID: 33849267
Ren Host immune defense peptide LL-37 activates caspase-independent apoptosis and suppresses colon cancer. Cancer Res. 2012 PMID: 23100468
Yang LL-37, the neutrophil granule- and epithelial cell-derived cathelicidin, utilizes formyl peptide receptor-like 1 (FPRL1) as a receptor to chemoattract human peripheral blood neutrophils, monocytes, and T cells. J.Exp.Med. 2000 PMID: 11015447
Steinstraesser Skin electroporation of a plasmid encoding hCAP-18/LL-37 host defense peptide promotes wound healing. Mol.Ther. 2014 PMID: 24394186
Seil Spotlight on human LL-37, an immunomodulatory peptide with promising cell-penetrating properties. Pharmaceuticals