Neuropeptide Y (human, rat)

Name: Neuropeptide Y (human, rat)
Brand: Tocris Bioscience
SKU: 1153
Rating: 5 (1 reviews)

Tocris Bioscience, part of Bio-Techne | Catalog # 1153

(1)

Citations (15)

COA / SDS

Influences feeding and sexual behavior

Key Product Details

Description:	Influences feeding and sexual behavior
Alternative Names:	NPY (human,rat)
Purity:	≥95% (HPLC)
Molecular Weight:	4271.7

View Full Technical Details for Neuropeptide Y (human, rat)

Technical Data
Citations / Reviews (1)

Biological Activity for Neuropeptide Y (human, rat)

Neuropeptide Y (human, rat) is a widely distributed endogenous neuropeptide involved in the control of food intake, sexual behavior and blood pressure.

Technical Data for Neuropeptide Y (human, rat)

M. Wt	4271.7
Formula	C₁₈₉H₂₈₅N₅₅O₅₇S
Single Letter Sequence	YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY (Modifications: Tyr-36 = C-terminal amide)
Storage	Store at -20°C
Purity	≥95% (HPLC)
CAS Number	90880-35-6
PubChem ID	24868177
InChi Key	XKWCTHKJQNUFOQ-HRPSIEBRSA-N
Smiles	[H]N[C@@H](CC1=CC=C(O)C=C1)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCCN)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(N)=O)C(=O)N1CCC[C@H]1C(=O)NCC(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](C)C(=O)N1CCC[C@H]1C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CO)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(N)=O

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

Tocris products are intended for laboratory research use only, unless stated otherwise.

Solubility for Neuropeptide Y (human, rat)

Solubility

Soluble to 1mg/ml in water

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

Mass

Concentration

Volume

M. Wt*

g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and CoA (available online).

Dilution Calculator

Calculate the dilution required to prepare a stock solution.

Concentration 1 (C1)

Volume 1 (V1)

Concentration 2 (C2)

Volume 2 (V2)

Reconstitution Calculator

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

Volume (to add to vial)

Mass (in vial)

Desired Reconstitution Concentration

References for Neuropeptide Y (human, rat)

References are publications that support the biological activity of the product.

Michel XVI. International Union of Pharmacology recommendations for the nomenclature of neuropeptide Y, peptide YY, and pancreatic polypeptide receptors. Pharmacol.Rev. 1998 PMID: 9549761
Minth Cloning, characterization, and DNA sequence of a human cDNA encoding neuropeptide tyrosine. Proc.Natl.Acad.Sci.U.S.A. 1984 PMID: 6589611
Allen Molecular structure of mammalian neuropeptide Y: analysis by molecular cloning and computer-aided comparison with crystal structure of avian homologue. Proc.Natl.Acad.Sci.U.S.A. 1987 PMID: 3031687