Nogo-66 (1-40)

Name: Nogo-66 (1-40)
Brand: Tocris Bioscience
SKU: 1984

Tocris Bioscience, part of Bio-Techne | Catalog # 1984

Citations (17)

COA / SDS

Competitive antagonist for Nogo-66 receptor; promotes neuron regeneration

Key Product Details

Description:	Competitive antagonist for Nogo-66 receptor; promotes neuron regeneration
Alternative Names:	NEP1-40,Nogo Extracellular Peptide,1-40
Purity:	≥95% (HPLC)
Molecular Weight:	4625.16

View Full Technical Details for Nogo-66 (1-40)

Technical Data
Citations

Biological Activity for Nogo-66 (1-40)

Nogo-66 (1-40) is a peptide fragment corresponding to residues 1 - 40 of Nogo-66, the domain of the myelin protein Nogo that inhibits axonal outgrowth. Acts as a competitive antagonist at the Nogo-66 receptor (NgR); blocks Nogo-66- and CNS myelin-induced inhibition of axonal growth, but does not reduce myelin-associated glycoprotein (MAG) inhibition of neurite outgrowth in vitro. Promotes regeneration of hemisected spinal axons and locomotor recovery following spinal injury in vivo.

Technical Data for Nogo-66 (1-40)

M. Wt	4625.16
Formula	C₂₀₆H₃₂₄N₅₆O₆₅
Single Letter Sequence	RIYKGVIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNS (Modifications: Arg-1 = N-terminal Ac, Ser-40 = C-terminal amide)
Storage	Store at -20°C
Purity	≥95% (HPLC)
CAS Number	475221-20-6
PubChem ID	16142739
InChi Key	OLEKMOOQFWTQGD-SJQNMCRDSA-N
Smiles	CC[C@H](C)[C@H](NC(=O)[C@H](C)NC(=O)[C@@H](NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC1=CC=C(O)C=C1)NC(=O)[C@H](C)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC1=CC=CC=C1)NC(=O)[C@@H]1CCCN1C(=O)[C@H](CC1=CNC=N1)NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCCCN)NC(=O)[C@H](CC1=CC=C(O)C=C1)NC(=O)[C@@H](NC(=O)[C@H](CCCNC(N)=N)NC(C)=O)[C@@H](C)CC)C(C)C)[C@@H](C)CC)[C@@H](C)CC)C(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CO)C(N)=O

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

Tocris products are intended for laboratory research use only, unless stated otherwise.

Solubility for Nogo-66 (1-40)

Solubility

Soluble to 1mg/ml in water

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

Mass

Concentration

Volume

M. Wt*

g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and CoA (available online).

Dilution Calculator

Calculate the dilution required to prepare a stock solution.

Concentration 1 (C1)

Volume 1 (V1)

Concentration 2 (C2)

Volume 2 (V2)

Reconstitution Calculator

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

Volume (to add to vial)

Mass (in vial)

Desired Reconstitution Concentration

References for Nogo-66 (1-40)

References are publications that support the biological activity of the product.

Liu Myelin-associated glycoprotein as a functional ligand for the Nogo-66 receptor. Science 2002 PMID: 12089450
Li and Strittmatter Delayed systemic Nogo-66 receptor antagonist promotes recovery from spinal cord injury. J.Neurosci. 2003 PMID: 12764110
GrandPre Nogo-66 receptor antagonist peptide promotes axonal regeneration. Nature 2002 PMID: 12037567