OD1

Name: OD1
Brand: Tocris Bioscience
SKU: 5941
Rating: 5 (1 reviews)

Tocris Bioscience, part of Bio-Techne | Catalog # 5941

(1)

Citations (2)

COA / SDS

Potent hNav1.4, rNav1.6 and rNav1.7 channel activator

Key Product Details

Description:	Potent hNa_v1.4, rNa_v1.6 and rNa_v1.7 channel activator
Purity:	≥95% (HPLC)
Molecular Weight:	7206.1

View Full Technical Details for OD1

Technical Data
Citations / Reviews (1)

Biological Activity for OD1

OD1 is a potent rat Na_v1.7, human Na_v1.4 and rat Na_v1.6 channel activator (EC₅₀ values are 7, 10 and 47 nM, respectively). Exhibits minimal activation at mammalian Na_v1.2, Na_v1.3 and Na_v1.5 (EC₅₀ values >3 μM). Inhibits fast inactivation on all channels. Increases peak currents at all voltages and stimulates a persistent Na⁺ current at hNa_v1.7 channel. Increases hyperpolarization at Na_v1.4 and Na_v1.6 channels. Induces spontaneous pain in vivo.

Technical Data for OD1

M. Wt	7206.1
Formula	C₃₀₈H₄₆₆N₉₀O₉₅S₈
Single Letter Sequence	GVRDAYIADDKNCVYTCASNGYCNTECTKNGAESGYCQWIGRYGNACWCIKLPDEVPIRIPGKCR (Modifications: Disulfide bridges: 13-64, 17-37, 23-47, 27-49, Arg-65 = C-terminal amide)
Storage	Store at -20°C
Purity	≥95% (HPLC)
PubChem ID	123773280
InChi Key	AGQDOUOEJSDDQH-BJQYWQRQSA-N
Smiles	[H]NCC(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@H]1CSSC[C@H](NC(=O)[C@H](CCCCN)NC(=O)CNC(=O)[C@@H]2CCCN2C(=O)[C@@H](NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@@H](NC(=O)[C@@H]2CCCN2C(=O)[C@@H](NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@@H]2CCCN2C(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCCN)NC(=O)[C@@H](NC(=O)[C@@H]2CSSC[C@@H]3NC(=O)[C@H](CC4=CC=C(O)C=C4)NC(=O)CNC(=O)[C@H](CO)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C)NC(=O)CNC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@@H](NC(=O)[C@@H]4CSSC[C@H](NC(=O)[C@@H](NC(=O)[C@H](CC5=CC=C(O)C=C5)NC(=O)[C@@H](NC1=O)C(C)C)[C@@H](C)O)C(=O)N[C@@H](C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(=O)NCC(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CSSC[C@H](NC(=O)[C@H](C)NC(=O)[C@H](CC(N)=O)NC(=O)CNC(=O)[C@H](CC1=CC=C(O)C=C1)NC(=O)[C@H](CCCNC(N)=N)NC(=O)CNC(=O)[C@@H](NC(=O)[C@H](CC1=CNC5=C1C=CC=C5)NC(=O)[C@H](CCC(N)=O)NC3=O)[C@@H](C)CC)C(=O)N[C@@H](CC1=CNC3=C1C=CC=C3)C(=O)N2)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCC(O)=O)C(=O)N4)[C@@H](C)O)[C@@H](C)CC)C(C)C)[C@@H](C)CC)[C@@H](C)CC)C(=O)N[C@@H](CCCNC(N)=N)C(N)=O

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

Tocris products are intended for laboratory research use only, unless stated otherwise.

Solubility for OD1

Solubility

Soluble to 1mg/ml in water

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

Mass

Concentration

Volume

M. Wt*

g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and CoA (available online).

Dilution Calculator

Calculate the dilution required to prepare a stock solution.

Concentration 1 (C1)

Volume 1 (V1)

Concentration 2 (C2)

Volume 2 (V2)

Reconstitution Calculator

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

Volume (to add to vial)

Mass (in vial)

Desired Reconstitution Concentration

References for OD1

References are publications that support the biological activity of the product.

Jalali OD1, the first toxin isolated from the venom of the scorpion Odonthobuthus doriae active on voltage-gated Na⁺ channels. FEBS Lett. 2005 PMID: 16038905
Maertens Potent modulation of the voltage-gated sodium channel Na_v1.7 by OD1, a toxin from the scorpion Odonthobuthus doriae. Mol.Pharmacol. 2006 PMID: 16641312
Durek Chemical engineering and structural and pharmacological characterization of the α-scorpion toxin OD1. ACS Chem.Biol. 2013 PMID: 23527544

OD1

Tocris Bioscience, part of Bio-Techne | Catalog # 5941

Key Product Details

Biological Activity for OD1

Technical Data for OD1

Solubility for OD1

Molarity Calculator

Dilution Calculator

Reconstitution Calculator

References for OD1

Product Documents for OD1

COA

Certificate of Analysis

SDS

CONTACT INFORMATION

保持关注