PACAP 1-38

Name: PACAP 1-38
Brand: Tocris Bioscience
SKU: 1186

Tocris Bioscience, part of Bio-Techne | Catalog # 1186

Citations (13)

COA / SDS

Potent stimulator of adenylyl cyclase

Key Product Details

Description:	Potent stimulator of adenylyl cyclase
Alternative Names:	Pituitary Adenylate Cyclase-Activating Polypeptide 1-38
Purity:	≥95% (HPLC)
Molecular Weight:	4534

View Full Technical Details for PACAP 1-38

Technical Data
Citations

Biological Activity for PACAP 1-38

PACAP 1-38 is a potent endogenous neuropeptide (IC₅₀ = 2 nM) showing considerable homology with vasoactive intestinal peptide (VIP) but with a greater potency for stimulation of adenylyl cyclase. PACAP 1-38 induces phosphorylation of NR2B and enhances NMDA receptor potentials.

Technical Data for PACAP 1-38

M. Wt	4534
Formula	C₂₀₃H₃₃₁N₆₃O₅₃S
Single Letter Sequence	HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK (Modifications: Lys-38 = C-terminal amide)
Storage	Store at -20°C
Purity	≥95% (HPLC)
CAS Number	137061-48-4
PubChem ID	44566111
InChi Key	UFTCZKMBJOPXDM-XXFCQBPRSA-N
Smiles	[H]N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(O)=O)C(=O)NCC(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C)C(=O)N[C@@H](C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCCN)C(N)=O

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

Tocris products are intended for laboratory research use only, unless stated otherwise.

Solubility for PACAP 1-38

Solubility

Soluble to 0.9mg/ml in water

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

Mass

Concentration

Volume

M. Wt*

g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and CoA (available online).

Dilution Calculator

Calculate the dilution required to prepare a stock solution.

Concentration 1 (C1)

Volume 1 (V1)

Concentration 2 (C2)

Volume 2 (V2)

Reconstitution Calculator

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

Volume (to add to vial)

Mass (in vial)

Desired Reconstitution Concentration

References for PACAP 1-38

References are publications that support the biological activity of the product.

Yaka Pituitary adenylate cyclase-activating polypeptide (PACAP(1-38)) enhances N-methyl-D-aspartate receptor function and brain-derived neurotrophic factor expression via RACK1. J.Biol.Chem. 2003 PMID: 12524444
Robberecht Structural requirements for the occupancy of pituitary adenylate-cyclase-activating-peptide (PACAP) receptors and adenylate cyclase activation in human neuroblastoma NB-OK-1 cell membranes. Discovery of PACAP(6-38) as a potent antagonist. Eur.J.Biochem. 1992 PMID: 1321043
Michel XVI. International Union of Pharmacology recommendations for the nomenclature of neuropeptide Y, peptide YY, and pancreatic polypeptide receptors. Pharmacol.Rev. 1998 PMID: 9549761
Rawlings Pituitary adenylate cyclase-activating polypeptide increase [Ca²⁺]i in rat gonadotrophs through an inositol trisphosphate-dependent mechanism. J.Biol.Chem. 1994 PMID: 7907085
Lazarovici The 38-amino-acid form of pituitary adenylate cyclase-activating polypeptide induces neurite outgrowth in PC12 cells that is dependent on protein kinase C and extracellular signal-regulated kinase but not on protein kinase A, nerve growth factor receptor Mol.Pharmacol. 1998 PMID: 9730914

PACAP 1-38

Tocris Bioscience, part of Bio-Techne | Catalog # 1186

Key Product Details

Key Product Details

Biological Activity for PACAP 1-38

Technical Data for PACAP 1-38

Solubility for PACAP 1-38

Molarity Calculator

Dilution Calculator

Reconstitution Calculator

References for PACAP 1-38

Product Documents for PACAP 1-38

COA

Certificate of Analysis

SDS

CONTACT INFORMATION

保持关注