Pancreatic Polypeptide (human)

Name: Pancreatic Polypeptide (human)
Brand: Tocris Bioscience
SKU: 1154
Rating: 4 (1 reviews)

Tocris Bioscience, part of Bio-Techne | Catalog # 1154

Citations (4)

COA / SDS

NPY Y4 agonist; involved in gastrointestinal tract function

Key Product Details

Description:	NPY Y₄ agonist; involved in gastrointestinal tract function
Purity:	≥95% (HPLC)
Molecular Weight:	4181.7

View Full Technical Details for Pancreatic Polypeptide (human)

Technical Data
Citations

Biological Activity for Pancreatic Polypeptide (human)

Pancreatic Polypeptide (human) is an endogenous high affinity agonist for human NPY Y₄ receptor (K_i = 0.056 nM). Believed to play an important role in the function of the gastrointestinal tract.

Technical Data for Pancreatic Polypeptide (human)

M. Wt	4181.7
Formula	C₁₈₅H₂₈₇N₅₃O₅₄S₂
Single Letter Sequence	APLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRY (Modification: Tyr-36 = C-terminal amide)
Storage	Store at -20°C
Purity	≥95% (HPLC)
CAS Number	75976-10-2
PubChem ID	24868176
InChi Key	HFDKKNHCYWNNNQ-YOGANYHLSA-N
Smiles	[H]N[C@@H](C)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N1CCC[C@H]1C(=O)NCC(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](C)C(=O)N[C@@H]([C@@H](C)O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](C)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(N)=O

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

Tocris products are intended for laboratory research use only, unless stated otherwise.

Solubility for Pancreatic Polypeptide (human)

Solubility

Soluble to 0.7mg/ml in water

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

Mass

Concentration

Volume

M. Wt*

g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and CoA (available online).

Dilution Calculator

Calculate the dilution required to prepare a stock solution.

Concentration 1 (C1)

Volume 1 (V1)

Concentration 2 (C2)

Volume 2 (V2)

Reconstitution Calculator

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

Volume (to add to vial)

Mass (in vial)

Desired Reconstitution Concentration

References for Pancreatic Polypeptide (human)

References are publications that support the biological activity of the product.

Gehlert Multiple receptors for the pancreatic polypeptide (PP-fold) family: physiological implications. Proc.Soc.Exp.Biol.Med. 1998 PMID: 9572148
Michel XVI. International Union of Pharmacology recommendations for the nomenclature of neuropeptide Y, peptide YY, and pancreatic polypeptide receptors. Pharmacol.Rev. 1998 PMID: 9549761
Bard Cloning and functional expression of a human Y₄ subtype receptor for pancreatic polypeptide, neuropeptide Y, and peptide YY. J.Biol.Chem. 1995 PMID: 7592911