Psalmotoxin 1

Name: Psalmotoxin 1
Brand: Tocris Bioscience
SKU: 5042

Tocris Bioscience, part of Bio-Techne | Catalog # 5042

Citations (3)

COA / SDS

Potent and selective ASIC1a channel blocker

Key Product Details

Description:	Potent and selective ASIC1a channel blocker
Alternative Names:	PcTx1
Purity:	≥95% (HPLC)
Molecular Weight:	4689.41

View Full Technical Details for Psalmotoxin 1

Technical Data
Citations

Biological Activity for Psalmotoxin 1

Psalmotoxin 1 is a potent and selective acid-sensing ion channel 1a (ASIC1a) blocker (IC₅₀ = 0.9 nM). Displays no effect at ASIC1b, ASIC2a, ASIC3, heteromeric ASIC channels, ENaC and K_V2.1/2.2/4.2/4.3 channels expressed in oocytes, at concentrations up to 100 nM. Displays potent analgesic properties against thermal, mechanical, chemical, inflammatory and neuropathic pain in rodents.

Technical Data for Psalmotoxin 1

M. Wt	4689.41
Formula	C₂₀₀H₃₁₂N₆₂O₅₇S₆
Single Letter Sequence	EDCIPKWKGCVNRHGDCCEGLECWKRRRSFEVCVPKTPKT (Modifications: Disulfide bridges: 3-18, 10-23, 17-33)
Storage	Store at -20°C
Purity	≥95% (HPLC)
CAS Number	316808-68-1
PubChem ID	90489000
InChi Key	LICLJUGDURFZIM-UHFFFAOYSA-N
Smiles	[H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@H]1CSSC[C@@H]2NC(=O)[C@@H]3CSSC[C@H](NC(=O)[C@@H](NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC4=CC=CC=C4)NC(=O)[C@H](CO)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CC4=CNC5=C4C=CC=C5)NC(=O)[C@H](CSSC[C@H](NC(=O)CNC(=O)[C@H](CCCCN)NC(=O)[C@H](CC4=CNC5=C4C=CC=C5)NC(=O)[C@H](CCCCN)NC(=O)[C@@H]4CCCN4C(=O)[C@@H](NC1=O)[C@@H](C)CC)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC1=CNC=N1)C(=O)NCC(=O)N[C@@H](CC(O)=O)C(=O)N3)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)CNC(=O)[C@H](CCC(O)=O)NC2=O)C(C)C)C(=O)N[C@@H](C(C)C)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCCN)C(=O)N[C@@H]([C@@H](C)O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCCN)C(=O)N[C@@H]([C@@H](C)O)C(O)=O

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

Tocris products are intended for laboratory research use only, unless stated otherwise.

Solubility for Psalmotoxin 1

Solubility

Soluble to 2mg/ml in water

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

Mass

Concentration

Volume

M. Wt*

g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and CoA (available online).

Dilution Calculator

Calculate the dilution required to prepare a stock solution.

Concentration 1 (C1)

Volume 1 (V1)

Concentration 2 (C2)

Volume 2 (V2)

Reconstitution Calculator

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

Volume (to add to vial)

Mass (in vial)

Desired Reconstitution Concentration

References for Psalmotoxin 1

References are publications that support the biological activity of the product.

Salinas The receptor site of the spider toxin PcTx1 on the proton-gated cation channel ASIC1a. J.Physiol. 2006 PMID: 16284080
Escoubas Isolation of a tarantula toxin specific for a class of proton-gated Na⁺ channels. J.Biol.Chem. 2000 PMID: 10829030
Escoubas Recombinant production and solution structure of PcTx1, the specific peptide inhibitor of ASIC1a proton-gated cation channels. Protein Sci. 2003 PMID: 12824480
Mazzuca A tarantula peptide against pain via ASIC1a channels and opioid mechanisms. Nat.Neurosci. 2007 PMID: 17632507