Thymosin β4

Name: Thymosin β4
Brand: Tocris Bioscience
SKU: 3390

Tocris Bioscience, part of Bio-Techne | Catalog # 3390

COA / SDS

Potent actin polymerization regulator

Discontinued Product

3390 has been discontinued. View all Actin-related Products products.

Key Product Details

Description:	Potent actin polymerization regulator
Molecular Weight:	4963.49

View Full Technical Details for Thymosin β4

Technical Data
Citations

Biological Activity for Thymosin β4

Thymosin β4 is a naturally occuring, potent regulator of actin polymerization present in human platelets at a concentration of 200 - 500 μM. Sequesters G-actin monomers in a 1:1 ratio (K_d = 0.7 - 1.0 μM) and allows rapid filament polymerization in the presence of profilin. Implicated in wound healing, induction of MMPs, chemotaxis, angiogenesis, inflammatory processes and tumor progression.

Technical Data for Thymosin β4

M. Wt	4963.49
Formula	C₂₁₂H₃₅₀N₅₆O₇₈S
Single Letter Sequence	SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES (Modifications: Ser-1 = N-terminal Ac)
Storage	Store at -20°C
CAS Number	77591-33-4
PubChem ID	90488838
InChi Key	QBEAMNLSDYIUGM-SIQRNXPUSA-N
Smiles	CC[C@H](C)[C@H](NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C)NC(=O)[C@H](CCSC)NC(=O)[C@H](CC(O)=O)NC(=O)[C@@H]1CCCN1C(=O)[C@H](CCCCN)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(C)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CC(C)C)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](C)C(=O)NCC(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CO)C(O)=O

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

Tocris products are intended for laboratory research use only, unless stated otherwise.

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

Mass

Concentration

Volume

M. Wt*

g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and CoA (available online).

Dilution Calculator

Calculate the dilution required to prepare a stock solution.

Concentration 1 (C1)

Volume 1 (V1)

Concentration 2 (C2)

Volume 2 (V2)

Reconstitution Calculator

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

Volume (to add to vial)

Mass (in vial)

Desired Reconstitution Concentration

References for Thymosin β4

References are publications that support the biological activity of the product.

Huff β-thymosins, small acidic peptides with multiple functions. Int.J.Biochem.Cell Biol. 2001 PMID: 11311852
Smart Thymosin β4 and angiogenesis: modes of action and therapeutic potential. Angiogenesis 2007 PMID: 17632766
Yu Thymosin β10 and thymosin β4 are both actin monomer sequestering proteins. J.Biol.Chem. 1993 PMID: 8416954

Thymosin β4

Tocris Bioscience, part of Bio-Techne | Catalog # 3390

Key Product Details

Biological Activity for Thymosin β4

Technical Data for Thymosin β4

Molarity Calculator

Dilution Calculator

Reconstitution Calculator

References for Thymosin β4

Product Documents for Thymosin β4

COA

Certificate of Analysis

SDS

CONTACT INFORMATION

保持关注