5-HT6 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-10817

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-10817-100ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

0.5 mg/ml

View all 5-HT6 Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human 5-HT6 (NP_000862.1). Peptide sequence VANIVQAVCDCISPGLFDVLTWLGYCNSTMNPIIYPLFMRDFKRALGRFL

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

48 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for 5-HT6 Antibody

Western Blot: 5-HT6 Antibody [NBP3-10817]

Western Blot: 5-HT6 Antibody [NBP3-10817]

Western Blot: 5-HT6 Antibody [NBP3-10817] - Western blot analysis of 5-HT6 in Human COLO205 Whole Cell lysates. Antibody dilution at 1ug/ml

Applications for 5-HT6 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: 5-HT6

5-HT6, a Serotonin Receptor, appears to regulate cholinergic neurotransmission in the brain rather than the expected interaction as a modulator of dopaminergic transmission. This interaction predicts a possible role for 5-HT6 Receptor antagonists in the treatment of learning and memory disorders. The 5-HT6 Receptor is abundant in limbic areas, which participate in the control of mood and emotion. Some antidepressants and antipsychotics are potent 5-HT6 Receptor antagonists, making this gene valuable for the pharmaceutical industry. 5-HT6 may be involved in the pathogenesis of mood disorders, schizophrenia, in Alzheimer's disease. A splice variant that has a 289bp deletion in the transmembrane region IV and the third intracellular loop has been isolated. 5-HT6 Receptor has been reported primarily in striatum of the brain. Expression has also been seen in stomach, spinal cord, and the lymphoid tissues of rats, including peripheral blood lymphocytes, spleen, and thymus. ESTs have been isolated from brain libraries.

Long Name

5-Hydroxytryptamine Receptor 6

Alternate Names

HTR6

Gene Symbol

HTR6

Additional 5-HT6 Products

Product Documents for 5-HT6 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for 5-HT6 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.