Skip to main content

ABCG1 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-54681

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-54681
NBP2-54681-25ul

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (90%), Rat (90%). Backed by our 100% Guarantee.

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Product Summary for ABCG1 Antibody

Immunogen

This antibody was developed against a Recombinant Protein corresponding to amino acids: AEMTEPKSVCVSVDEVVSSNMEATETDLLNGHLKKVDNNLTEAQRFSSLPRRAAVNIEFRDLSYSVPEG

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

75.59 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for ABCG1 Antibody

Immunocytochemistry/ Immunofluorescence: ABCG1 Antibody [NBP2-54681]

Immunocytochemistry/ Immunofluorescence: ABCG1 Antibody [NBP2-54681]

Immunocytochemistry/Immunofluorescence: ABCG1 Antibody [NBP2-54681] - Immunofluorescent staining of human cell line HeLa shows localization to nucleoplasm, the Golgi apparatus & vesicles.

Applications for ABCG1 Antibody

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ABCG1

ABCG1 (ATP-binding cassette sub-family G member 1) is a member of the ABC superfamily of transporters, specifically the ABCG (White) subfamily, that is characterized by their ABC domain organization (1). The ABC domains are around 180 amino acids (aa) in length and contain three conserved domains: Walker A motif (12 aa), Walker B motif (5 aa), and Signature motif (5 aa) (1, 2). Functional ABC transporters are comprised of two ABCs and two transmembrane domains (TMDs), where each TMD contains six TM alpha-helices (1-3). ABCG1 is considered a "half" transporter because it only has one ABC domain and one TMD (1-3). In order to be functional, ABCG1 and other half transporters can form homodimers or heterodimers (1-3). ABCG1 has a theoretical molecular weight of 102 kDa and is highly expressed in cells including macrophages, lymphocytes, and neurons (2). Additionally, ABCG1 is shown to be highly expressed in lung, kidney, brain, and spleen tissue (2). Specifically, ABCG1 is presented on the cell surface and in intracellular compartments of cholesterol-rich macrophages and, consequently, plays a crucial role in cholesterol regulation and homeostasis (3-5). ABCG1 is involved in the export, or efflux, of cholesterol and phospholipids from macrophages to high density lipoproteins (HDL) for eventual excretion via the liver.

A variety of cardiovascular and cardiometabolic diseases are associated with ABCG1 dysfunction (5-7). Macrophages can become cholesterol-containing foam cells that are generated by the uptake of low-density lipoproteins (LDL), cholesterol esterification, and compromised cholesterol efflux machinery in transporters like ABCG1 and ABCA1 (2, 5, 6, 7). Foam cells are associated with the chronic, inflammatory disease atherosclerosis which is characterized by arterial buildup of plaques that can ultimately lead to cardiovascular disease (5, 6, 7). Additionally, ABCG1 has a critical role in cardiometabolic disorders. Studies have found that diabetic mice have decreased ABCG1 expression (8). Furthermore, loss of ABCG1 in mouse pancreatic beta cells ultimately leads to impaired insulin secretion, suggesting that inhibition or modulation of ABCG1 may contribute to development of diabetes and obesity (8). Finally, other related ATP-binding cassette transporter family members, such as ABCA1 and ABCG5/8, have been associated with genetically-inherited syndromes like Tangier disease, characterized by reduced levels of HDL in the blood, and Sitosterolemia, characterized by elevated plant sterol lipid accumulation in blood and tissues (7). .

Alternate names for ABCG1 includes ABC transporter 8 (ABC8), ATP-binding cassette transporter, anti-, sub-family G (WHITE), homolog of Drosophila white, and MGC34313. .

References

1. Tarling E. J. (2013). Expanding roles of ABCG1 and sterol transport. Current opinion in lipidology. https://doi.org/10.1097/MOL.0b013e32835da122.

2. Tarr, P. T., Tarling, E. J., Bojanic, D. D., Edwards, P. A., & Baldan, A. (2009). Emerging new paradigms for ABCG transporters. Biochimica et biophysica acta.https://doi.org/10.1016/j.bbalip.2009.01.007.

3. Tarling, E. J., & Edwards, P. A. (2011). ATP binding cassette transporter G1 (ABCG1) is an intracellular sterol transporter. Proceedings of the National Academy of Sciences of the United States of America. https://doi.org/10.1073/pnas.1113021108.

4. Phillips M. C. (2014). Molecular mechanisms of cellular cholesterol efflux. The Journal of biological chemistry, 289(35), 24020-24029. https://doi.org/10.1074/jbc.R114.583658.

5. Ouimet, M., Barrett, T. J., & Fisher, E. A. (2019). HDL and Reverse Cholesterol Transport. Circulation research. https://doi.org/10.1161/CIRCRESAHA.119.312617.

6. Yu, X. H., Fu, Y. C., Zhang, D. W., Yin, K., & Tang, C. K. (2013). Foam cells in atherosclerosis. Clinica chimica acta; international journal of clinical chemistry. https://doi.org/10.1016/j.cca.2013.06.006

Long Name

ATP-binding Cassette, Sub-family G (WHITE), Member 1

Alternate Names

ABC8, WHITE1, WHT1

Gene Symbol

ABCG1

Additional ABCG1 Products

Product Documents for ABCG1 Antibody

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for ABCG1 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...