ACBP Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-54806

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-54806
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

0.5 mg/ml

View all ACBP Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to DBI(diazepam binding inhibitor (GABA receptor modulator, acyl-Coenzyme A binding protein)) The peptide sequence was selected from the N terminal of DBI. Peptide sequence MSQAEFEKAAEEVRHLKTKPSDEEMLFIYGHYKQATVGDINTERPGMLDF The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

10 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for ACBP Antibody

Western Blot: ACBP Antibody [NBP1-54806]

Western Blot: ACBP Antibody [NBP1-54806]

Western Blot: ACBP Antibody [NBP1-54806] - Sample Tissue: Human Ovary Tumor Antibody Dilution: 1.0 ug/ml
Immunohistochemistry-Paraffin: ACBP Antibody [NBP1-54806]

Immunohistochemistry-Paraffin: ACBP Antibody [NBP1-54806]

Immunohistochemistry-Paraffin: ACBP Antibody [NBP1-54806] - Human Brain, cerebellum tissue at an antibody concentration of 5ug/ml.
Western Blot: ACBP Antibody [NBP1-54806]

Western Blot: ACBP Antibody [NBP1-54806]

Western Blot: ACBP Antibody [NBP1-54806] - Reccomended Titration: 0.2 - 1 ug/ml ELISA Titer: 1:1562500 Positive Control: Human Liver

Applications for ACBP Antibody

Application
Recommended Usage

Immunohistochemistry

1:10-1:500

Immunohistochemistry-Paraffin

5 ug/ml

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ACBP

DBI is diazepam binding inhibitor. The protein that is regulated by hormones and is involved in lipid metabolism and the displacement of beta-carbolines and benzodiazepines, which modulate signal transduction at type A gamma-aminobutyric acid receptors located in brain synapses. DBI is conserved from yeast to mammals, with the most highly conserved domain consisting of seven contiguous residues that constitute the hydrophobic binding site for medium- and long-chain acyl-Coenzyme A esters. Diazepam binding inhibitor is also known to mediate the feedback regulation of pancreatic secretion and the postprandial release of cholecystokinin, in addition to its role as a mediator in corticotropin-dependent adrenal steroidogenesis. Three pseudogenes located on chromosomes 6, 8 and 16 have been identified. Multiple transcript variants encoding different isoforms have been described for this gene. This gene encodes diazepam binding inhibitor, a protein that is regulated by hormones and is involved in lipid metabolism and the displacement of beta-carbolines and benzodiazepines, which modulate signal transduction at type A gamma-aminobutyric acid receptors located in brain synapses. The protein is conserved from yeast to mammals, with the most highly conserved domain consisting of seven contiguous residues that constitute the hydrophobic binding site for medium- and long-chain acyl-Coenzyme A esters. Diazepam binding inhibitor is also known to mediate the feedback regulation of pancreatic secretion and the postprandial release of cholecystokinin, in addition to its role as a mediator in corticotropin-dependent adrenal steroidogenesis. Three pseudogenes located on chromosomes 6, 8 and 16 have been identified. Multiple transcript variants encoding different isoforms have been described for this gene.

Long Name

Acyl-CoA-binding protein

Alternate Names

DBI, Endozepine, EP

Gene Symbol

DBI

UniProt

P07108 (Human)

Additional ACBP Products

Product Documents for ACBP Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for ACBP Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.