Activin RIA/ALK-2/Activin Receptor Type 1 Antibody (1J7G4)

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-15732

Recombinant Monoclonal Antibody
Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-15732-100ul
NBP3-15732-20ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 1J7G4

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

View all Activin RIA/ALK-2 Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 410-509 of human Activin RIA/ALK-2/Activin Receptor Type 1 (Q04771). VLWEVARRMVSNGIVEDYKPPFYDVVPNDPSFEDMRKVVCVDQQRPNIPNRWFSDPTLTSLAKLMKECWYQNPSARLTALRIKKTLTKIDNSLDKLKTDC

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Activin RIA/ALK-2/Activin Receptor Type 1 Antibody (1J7G4)

Western Blot: Activin RIA/ALK-2/Activin Receptor Type 1 Antibody (1J7G4) [NBP3-15732]

Western Blot: Activin RIA/ALK-2/Activin Receptor Type 1 Antibody (1J7G4) [NBP3-15732]

Western Blot: Activin RIA/ALK-2/Activin Receptor Type 1 Antibody (1J7G4) [NBP3-15732] - Western blot analysis of extracts of Mouse brain, using Activin RIA/ALK-2/Activin Receptor Type 1 antibody (NBP3-15732) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.
Western Blot: Activin RIA/ALK-2/Activin Receptor Type 1 Antibody (1J7G4) [NBP3-15732]

Western Blot: Activin RIA/ALK-2/Activin Receptor Type 1 Antibody (1J7G4) [NBP3-15732]

Western Blot: Activin RIA/ALK-2/Activin Receptor Type 1 Antibody (1J7G4) [NBP3-15732] - Western blot analysis of extracts of various cell lines, using Activin RIA/ALK-2/Activin Receptor Type 1 antibody (NBP3-15732) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.

Applications for Activin RIA/ALK-2/Activin Receptor Type 1 Antibody (1J7G4)

Application
Recommended Usage

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 0.05% BSA, 50% glycerol, pH7.3

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Activin RIA/ALK-2

Activins are dimeric growth and differentiation factors which belong to the transforming growth factor-beta (TGF-beta) superfamily of structurally related signaling proteins. Activins signal through a heteromeric complex of receptor serine kinases which include at least two type I ( I and IB) and two type II (II and IIB) receptors. These receptors are all transmembrane proteins, composed of a ligand-binding extracellular domain with cysteine-rich region, a transmembrane domain, and a cytoplasmic domain with predicted serine/threonine specificity. Type I receptors are essential for signaling; and type II receptors are required for binding ligands and for expression of type I receptors. Type I and II receptors form a stable complex after ligand binding, resulting in phosphorylation of type I receptors by type II receptors. This gene encodes activin A type I receptor which signals a particular transcriptional response in concert with activin type II receptors. Mutations in this gene are associated with fibrodysplasia ossificans progressive.

Long Name

Activin Receptor IA

Alternate Names

ActivinRIA, ACVR1, ALK-2, ALK2

Gene Symbol

ACVR1

Additional Activin RIA/ALK-2 Products

Product Documents for Activin RIA/ALK-2/Activin Receptor Type 1 Antibody (1J7G4)

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for Activin RIA/ALK-2/Activin Receptor Type 1 Antibody (1J7G4)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.