Adenylate Cyclase 5 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-10868

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-10868-100ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

0.5 mg/ml

View all Adenylate Cyclase 5 Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human Adenylate Cyclase 5 (NP_001186571.1). Peptide sequence EELQAYNRRLLHNILPKDVAAHFLARERRNDELYYQSCECVAVMFASIAN

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

138 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Adenylate Cyclase 5 Antibody

Western Blot: Adenylate Cyclase 5 Antibody [NBP3-10868]

Western Blot: Adenylate Cyclase 5 Antibody [NBP3-10868]

Western Blot: Adenylate Cyclase 5 Antibody [NBP3-10868] - Western blot analysis of Adenylate Cyclase 5 in Human 786-0 Whole Cell lysates. Antibody dilution at 1ug/ml

Applications for Adenylate Cyclase 5 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Adenylate Cyclase 5

ADCY5, also known as Adenylate cyclase type 5, consists of a 1,261 amino acid long isoform that is 139 kDa and a shorter 911 amino acid isoform that is 103 kDa, and is involved in the encoding of a membrane-bound enzyme. This protein has also been shown to have interactions with ADCY2, GNAS, PRKACA, GNAI1, and PRKCA in the Signaling by FGFR, PKA activation in glucagon signaling, DAG and IP3 signaling, Regulation of Water Balance by Renal Aquaporins, and Opioid Signalling pathway. Disease research is currently being studied with relation to ADCY5 and pancreatitis, leukemia, precocious puberty, and immunodeficiency.

Long Name

Adenylate cyclase type 5

Alternate Names

AC5, ADCY5, Adenylyl cyclase 5

Gene Symbol

ADCY5

Additional Adenylate Cyclase 5 Products

Product Documents for Adenylate Cyclase 5 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Adenylate Cyclase 5 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.