Adenylate Kinase 1 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-35229

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-35229-100ul
NBP3-35229-20ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse

Applications

ELISA, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

View all Adenylate Kinase 1 Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-194 of human Adenylate Kinase 1 (NP_000467.1).

Sequence:
MEEKLKKTKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRSEVSSGSARGKKLSEIMEKGQLVPLETVLDMLRDAMVAKVNTSKGFLIDGYPREVQQGEEFERRIGQPTLLLYVDAGPETMTQRLLKRGETSGRVDDNEETIKKRLETYYKATEPVIAFYEKRGIVRKVNAEGSVDSVFSQVCTHLDALK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Adenylate Kinase 1 Antibody

Adenylate Kinase 1 Antibody

Immunohistochemistry: Adenylate Kinase 1 Antibody [NBP3-35229] -

Immunohistochemistry: Adenylate Kinase 1 Antibody [NBP3-35229] - Immunohistochemistry analysis of paraffin-embedded Mouse heart using Adenylate Kinase 1 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
Adenylate Kinase 1 Antibody

Western Blot: Adenylate Kinase 1 Antibody [NBP3-35229] -

Western Blot: Adenylate Kinase 1 Antibody [NBP3-35229] - Western blot analysis of various lysates using Adenylate Kinase 1 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Adenylate Kinase 1 Antibody

Immunocytochemistry/ Immunofluorescence: Adenylate Kinase 1 Antibody [NBP3-35229] -

Immunocytochemistry/ Immunofluorescence: Adenylate Kinase 1 Antibody [NBP3-35229] - Immunofluorescence analysis of HeLa cells using Adenylate Kinase 1 Rabbit pAb. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
View 1 more images

Applications for Adenylate Kinase 1 Antibody

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Adenylate Kinase 1

Adenylate kinase is an enzyme involved in regulating the adenine nucleotide composition within a cell by catalyzing the reversible transfer of phosphate group among adinine nucleotides. Three isozymes of adenylate kinase have been identified in vertebrates, adenylate isozyme 1 (AK1), 2 (AK2) and 3 (AK3). AK1 is found in the cytosol of skeletal muscle, brain and erythrocytes, whereas AK2 and AK3 are found in the mitochondria of other tissues including liver and heart. AK1 was identified because of its association with a rare genetic disorder causing nonspherocytic hemolytic anemia where a mutation in the AK1 gene was found to reduce the catalytic activity of the enzyme.

Long Name

Adenylate kinase isoenzyme 1

Alternate Names

AK 1, AK1, EC 2.7.4.3, EC 2.7.4.6, Myokinase

Gene Symbol

AK1

Additional Adenylate Kinase 1 Products

Product Documents for Adenylate Kinase 1 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for Adenylate Kinase 1 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.