AKAP10 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-56509

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-56509
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

0.5 mg/ml

View all AKAP10 Antibodies »

Product Specifications

Immunogen

Synthetic peptide directed towards the middle region of human AKAP10 (NP_009133). Peptide sequence ESLYQRTYAGKMTFGRVSDLGQFIRESEPEPDVRKSKGSMFSQAMKKWVQ. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

71 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for AKAP10 Antibody

Western Blot: AKAP10 Antibody [NBP1-56509]

Western Blot: AKAP10 Antibody [NBP1-56509]

Western Blot: AKAP10 Antibody [NBP1-56509] - RPMI 8226 cell lysate, concentration 0.2-1 ug/ml.
Western Blot: AKAP10 Antibody [NBP1-56509]

Western Blot: AKAP10 Antibody [NBP1-56509]

Western Blot: AKAP10 Antibody [NBP1-56509] - Analysis of 293T cell lysate. Antibody Dilution: 1.0 ug/ml AKAP10 is supported by BioGPS gene expression data to be expressed in HEK293T.

Applications for AKAP10 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: AKAP10

The A-kinase anchor proteins (AKAPs) are a group of structurally diverse proteins, which have the common function of binding to the regulatory subunit of protein kinase A (PKA) and confining the holoenzyme to discrete locations within the cell. This gene encodes a member of the AKAP family. The encoded protein interacts with both the type I and type II regulatory subunits of PKA; therefore, it is a dual-specific AKAP. This protein is highly enriched in mitochondria. It contains RGS (regulator of G protein signalling) domains, in addition to a PKA-RII subunit-binding domain. The mitochondrial localization and the presence of RGS domains may have important implications for the function of this protein in PKA and G protein signal transduction.

Alternate Names

A kinase (PRKA) anchor protein 10, AKAP-10, A-kinase anchor protein 10, mitochondrial, D-AKAP2, D-AKAP-2, Dual specificity A kinase-anchoring protein 2, dual-specificity A-kinase anchoring protein 2, MGC9414, mitochondrial A kinase PPKA anchor protein 10, PRKA10a kinase anchor protein 10, mitochondrial, protein kinase A anchoring protein 10, Protein kinase A-anchoring protein 10

Entrez Gene IDs

11216 (Human)

Gene Symbol

AKAP10

UniProt

O43572 (Human)

Additional AKAP10 Products

Product Documents for AKAP10 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for AKAP10 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.