AKR1B1 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-53144

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-53144
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

0.5 mg/ml

View all AKR1B1 Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to AKR1B1(aldo-keto reductase family 1, member B1 (aldose reductase)) The peptide sequence was selected from the N terminal of AKR1B1. Peptide sequence ASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQN. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

36 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for AKR1B1 Antibody

Western Blot: AKR1B1 Antibody [NBP1-53144]

Western Blot: AKR1B1 Antibody [NBP1-53144]

Western Blot: AKR1B1 Antibody [NBP1-53144] - Reccomended Titration: 0.2 - 1 ug/ml ELISA Titer: 1:312500 Positive Control: MCF7 cell lysate
Immunohistochemistry: AKR1B1 Antibody [NBP1-53144]

Immunohistochemistry: AKR1B1 Antibody [NBP1-53144]

Immunohistochemistry: AKR1B1 Antibody [NBP1-53144] - Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue Observed Staining: Cytoplasmic Primary Antibody Concentration: N/A Other Working Concentrations: 1:600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec
Western Blot: AKR1B1 Antibody [NBP1-53144]

Western Blot: AKR1B1 Antibody [NBP1-53144]

Western Blot: AKR1B1 Antibody [NBP1-53144] - MCF-7 whole cell lysates, concentration 0.2-1 ug/ml.

Applications for AKR1B1 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: AKR1B1

AKR1B1 is a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. This member catalyzes the reduction of a number of aldehydes, including the aldehyde form of glucose, and is thereby implicated in the development of diabetic complications by catalyzing the reduction of glucose to sorbitol. This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. This member catalyzes the reduction of a number of aldehydes, including the aldehyde form of glucose, and is thereby implicated in the development of diabetic complications by catalyzing the reduction of glucose to sorbitol. There are a few putative pseudogenes for this gene, and one of them has been confirmed and mapped to chromosome 3. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Alternate Names

ADR, Aldehyde reductase, Aldo-keto reductase family 1 member B1, aldo-keto reductase family 1, member B1 (aldose reductase), ALDR1aldose reductase, ALR2, ARaldehyde reductase 1, EC 1.1.1, EC 1.1.1.21, Lii5-2 CTCL tumor antigen, low Km aldose reductase, MGC1804

Entrez Gene IDs

231 (Human)

Gene Symbol

AKR1B1

UniProt

P15121 (Human)

Additional AKR1B1 Products

Product Documents for AKR1B1 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for AKR1B1 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.