APEX2 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-84441

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-84441-0.1ml
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

0.5 mg/ml

View all APEX2 Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human APEX2. Peptide sequence: LMTPKTPEEKAVAKVVKGQAKTSEAKDEKELRTSFWKSVLAGPLRTPLCG The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for APEX2 Antibody

Western Blot: APEX2 Antibody [NBP2-84441]

Western Blot: APEX2 Antibody [NBP2-84441]

Western Blot: APEX2 Antibody [NBP2-84441] - Samples: lane 1-5: U2OS cell lysate, lanes 6 HEK293T cell lysate. Lane 1: non-targeting siRNA control, lane 2: APEX2_5 siRNA, lanes 3: APEX2_6 siRNA, lanes 4: APEX2_7 siRNA, lanes 5: APEX2_8 siRNA. Below: loading control, anti-actin mouse ab 1:5000. Western blot conditions: Cells were pelleted and lysed in RIPA buffer with protease inhibitors. Lysates were centrifuged at 16 000 g for 10 min and 9 ug of lysate was loaded in each lane on a 4-15% SDS-PAGE gel. Samples were transferred on a nitrocellulose membrane and blocked with 1.5% BSA O/N. NBP2-84441 antibody was diluted 1:500 (1 ug/ml) in TBST and incubated for 2 h. IImage from verified customer review.
Western Blot: APEX2 Antibody [NBP2-84441]

Western Blot: APEX2 Antibody [NBP2-84441]

Western Blot: APEX2 Antibody [NBP2-84441] - Host: Rabbit. Target Name: APEX2. Sample Tissue: Human Testicular Tumor lysates. Antibody Dilution: 1ug/ml

Applications for APEX2 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Reviewed Applications

Read 1 review rated 4 using NBP2-84441 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: APEX2

Apurinic/apyrimidinic (AP) sites occur frequently in DNA molecules by spontaneous hydrolysis, by DNA damaging agents or by DNA glycosylases that remove specific abnormal bases. AP sites are pre-mutagenic lesions that can prevent normal DNA replication so the cell contains systems to identify and repair such sites. Class II AP endonucleases cleave the phosphodiester backbone 5' to the AP site. This gene encodes a protein shown to have a weak class II AP endonuclease activity. Most of the encoded protein is located in the nucleus but some is also present in mitochondria. This protein may play an important role in both nuclear and mitochondrial base excision repair (BER). [provided by RefSeq]

Alternate Names

AP endonuclease 2, APE2, APEX nuclease (apurinic/apyrimidinic endonuclease) 2, APEX nuclease 2, APEXL2, Apurinic-apyrimidinic endonuclease 2, DNA-(apurinic or apyrimidinic site) lyase 2, DNA-apurinic or apyrimidinic site lyase 2, EC 3.1, EC 4.2.99.18, XTH2

Gene Symbol

APEX2

Additional APEX2 Products

Product Documents for APEX2 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for APEX2 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.