Apolipoprotein A-II/ApoA2 Antibody (5F7U1)

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-16168

Recombinant Monoclonal Antibody
Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-16168-100ul
NBP3-16168-20ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human, Mouse, Rat

Applications

ELISA, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 5F7U1

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

View all Apolipoprotein A-II/ApoA2 Antibodies »

Product Summary for Apolipoprotein A-II/ApoA2 Antibody (5F7U1)

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-110 of human Apolipoprotein A-II/ApoA2 (NP_001634.1). MKLLAATVLLLTICSLEGALVRRQAKEPCVESLVSQYFQTVTDYGKDLMEKVKSPELQAEAKSYFEKSKEQLTPLIKKAGTELVNFLSYFVELGTQPATQ

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

17 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Apolipoprotein A-II/ApoA2 Antibody (5F7U1)

Western Blot: Apolipoprotein A-II/ApoA2 Antibody (5F7U1) [NBP3-16168]

Western Blot: Apolipoprotein A-II/ApoA2 Antibody (5F7U1) [NBP3-16168]

Western Blot: Apolipoprotein A-II/ApoA2 Antibody (5F7U1) [NBP3-16168] - Western blot analysis of extracts of Human plasma cells, using Apolipoprotein A-II/ApoA2 antibody (NBP3-16168) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.
Immunohistochemistry: Apolipoprotein A-II/ApoA2 Antibody (5F7U1) [NBP3-16168]

Immunohistochemistry: Apolipoprotein A-II/ApoA2 Antibody (5F7U1) [NBP3-16168]

Immunohistochemistry: Apolipoprotein A-II/ApoA2 Antibody (5F7U1) [NBP3-16168] - Analysis of mouse liver using Apolipoprotein A-II/ApoA2 Rabbit mAb (NBP3-16168) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunohistochemistry: Apolipoprotein A-II/ApoA2 Antibody (5F7U1) [NBP3-16168]

Immunohistochemistry: Apolipoprotein A-II/ApoA2 Antibody (5F7U1) [NBP3-16168]

Immunohistochemistry: Apolipoprotein A-II/ApoA2 Antibody (5F7U1) [NBP3-16168] - Analysis of rat liver using Apolipoprotein A-II/ApoA2 Rabbit mAb (NBP3-16168) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Applications for Apolipoprotein A-II/ApoA2 Antibody (5F7U1)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:1000
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 0.05% BSA, 50% glycerol, pH7.3

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Apolipoprotein A-II/ApoA2

At least 9 distinct polymorphic forms of apolipoproteins are known. The apolipoproteins act as stabilizers of the intact lipoprotein particles. Quantitative measurements of HDL, LDL and VLDL particles in human serum are often used to estimate an individuals' relative risk of coronary heart disease. In addition, quantitative immunological measurements of certain apolipoproteins (especially A-1 and B) have been suggested to be more accurate estimators of coronary heart disease than measurements of lipoprotein particles (especially HDL and LDL). This apo-lipoprotein antibody is derived from human plasma by density gradient ultracentrifugation and HPLC.

Alternate Names

Alp-2, APOA2, Apolipoprotein AII, Hdl-1

Gene Symbol

APOA2

Additional Apolipoprotein A-II/ApoA2 Products

Product Documents for Apolipoprotein A-II/ApoA2 Antibody (5F7U1)

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for Apolipoprotein A-II/ApoA2 Antibody (5F7U1)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.